KEGG   Bos taurus (cow): 504482Help
Entry
504482            CDS       T01008                                 

Gene name
WASF2
Definition
(RefSeq) wiskott-Aldrich syndrome protein family member 2
  KO
K05748  WAS protein family, member 2
Organism
bta  Bos taurus (cow)
Pathway
bta04520  Adherens junction
bta04666  Fc gamma R-mediated phagocytosis
bta04810  Regulation of actin cytoskeleton
bta05100  Bacterial invasion of epithelial cells
bta05135  Yersinia infection
bta05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    504482 (WASF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    504482 (WASF2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    504482 (WASF2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    504482 (WASF2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    504482 (WASF2)
   05100 Bacterial invasion of epithelial cells
    504482 (WASF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bta04812]
    504482 (WASF2)
Cytoskeleton proteins [BR:bta04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     504482 (WASF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH2 WASH_WAHD RasGAP
Motif
Other DBs
NCBI-GeneID: 504482
NCBI-ProteinID: NP_001074980
BGD-bta: BT13549
Ensembl: ENSBTAG00000018374
VGNC: 36866
UniProt: A2VDK6
Position
2
AA seq 493 aa AA seqDB search
MPLVTRNIEPRHLCRQTLPSVRSELECMTNITLANVIRQLGSLSKYAEDIFGELFTQANT
FASRVSSLAERVDRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTVQDQKLFDRNSLPIPV
LETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIMKEKRKHRK
EKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKPSRYPPTLVYQNGSIGSVENVD
AGNYPPPPQSDSISPPSPSFSEDNLPPPPAEFSYPADNNQRAGLKRSSVVSPSHPPPAPP
LGSAPGPKPGFAPPPAPPPPPPMINTPPPPPPGGFGSPATPPPPSPPSFPPHPDFAAPPP
PPPPPAVDYSTLPPPPLSQSAGGAPPPPPPPPPPGPPPPPFSGADGQLAAPPPPLSDTTK
PKSSLPPVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVEYSDSE
DDSSEFDEDEWSD
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgccgttagtaacgaggaacatcgagccaaggcacctgtgccgtcagacgttgcctagc
gttagaagcgagctggaatgcatgaccaacatcaccctggcaaatgtcatccgacagctg
ggcagcctgagtaaatatgccgaggacatttttggagagctctttactcaggcaaatact
tttgcctctcgggtaagctcccttgctgagagggtcgaccgcctacaagttaaagtcact
cagctggatcccaaggaagaagaagtatcactacaaggaatcaacacccgaaaggccttc
agaagctctactgttcaagaccagaagctctttgacagaaactctctccccatacctgtt
ttggaaacatacaacacctgtgatactcctccacctctcaacaaccttaccccttacagg
gacgatgggaaagaggcactcaaattctacacagacccttcgtacttctttgatctttgg
aaggagaagatgctgcaggacaccaaggatatcatgaaagagaagaggaagcataggaaa
gaaaagaaagataatccaaatcgaggaaatgtaaacccacgtaaaatcaagacacgtaag
gaagagtgggagaaaatgaagatgggtcaagaatttgtggaatccaaagaaaagccttct
cggtatccacccaccttggtgtaccagaatggcagcattggctctgttgagaatgtggat
gcaggcaactatccaccaccaccacagtcagactccatttctccaccttctccttccttc
tctgaggacaacttgcctcccccaccagcagaattcagctacccggcagacaataaccaa
agagctggactcaaaaggtccagtgtggtcagcccaagccacccaccgccagctcctcct
ctgggctctgcgccaggccccaaacccgggtttgctccaccacctgcccctccgcctcca
cctccgatgataaacactccacccccaccaccacctggaggatttgggtctccagcgacc
cctccaccaccttcacccccatctttcccgcctcaccccgattttgctgcccctccacct
cctcccccaccgccggcagttgactactcgactctgccaccacctcccttgtcccagtca
gcaggaggcgcacctccgcctccgcccccgccccctcctccagggccccctccgccccct
ttcagtggtgcagatggccagctggctgcacctcctccgccactttctgacaccaccaag
cccaagtcctccttgcctcctgtgagcgatgcccgcagcgacttgctttcagccatccgt
caaggctttcagctgcgcagggttgaggagcagcgggaacaagagaagcgggatgttgtg
ggcaacgacgtggccaccatcctgtcgcgtcgcattgctgtggagtacagcgattcggaa
gacgactcctctgagtttgatgaagacgaatggtcggattaa

DBGET integrated database retrieval system