KEGG   Bos taurus (cow): 504511Help
Entry
504511            CDS       T01008                                 

Gene name
AK9
Definition
(RefSeq) adenylate kinase 9 isoform X2
  KO
K18533  adenylate/nucleoside-diphosphate kinase [EC:2.7.4.3 2.7.4.6]
Organism
bta  Bos taurus (cow)
Pathway
bta00230  Purine metabolism
bta00240  Pyrimidine metabolism
bta01100  Metabolic pathways
Module
bta_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
bta_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
bta_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    504511 (AK9)
   00240 Pyrimidine metabolism
    504511 (AK9)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     504511 (AK9)
    2.7.4.6  nucleoside-diphosphate kinase
     504511 (AK9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADK AAA_17 AAA_18 AAA_33 AAA_28 AAA YHS AAA_24 AAA_16 AAA_22 FAP206 RNA_helicase AAA_5 AAA_14 NACHT Cytidylate_kin ABC_tran NB-ARC SKI MMR_HSR1 RuvB_N NTPase_1 AAA_19 Hydin_ADK AAA_30 ATPase_2 ZZ
Motif
Other DBs
NCBI-GeneID: 504511
NCBI-ProteinID: XP_005210886
BGD-bta: BT13924
Ensembl: ENSBTAG00000010116
VGNC: 25778
Position
9
AA seq 1906 aa AA seqDB search
MTSQEKTEKHPFADIFNEDEADINFMLSKPVCFVVFGKPGVGKTTLAQQITQAWKCIRVE
ALPILEEQIASDTVTGAMLQSMLISGQSIPDELVTKLMLDKLNSSEVSHFGYIITEIPSL
SQDAMTTLQQIELIRNLKLKPDIIINIKCPDYDLCQRISGQRQHSTTGYIYTRDQWDPEV
IENRRKKKKEAQKEGKGEEEGEEEEEQEEEEAFIAEMQIVAEVLQHLVQRPEDYLENIEH
IVNLYKEIILHPLEEVMAEHDSQYLIELDGNKPPEELFMTVMDRLKYLNLKRAAVITKLQ
STEEDINDTMENDELFRTLASYKLIAPRYRWQRSRWGRTCPVTLKEGNIFQGLPDFSVSF
LGKMYCLSSEEALKTFLLNPRPYLIPPMPAPPFKVFIFGPQSSGKTTLSNLLAKHYKGKV
VDYDKVIQPRFDKALEMLTRNTIAEATEAAIKVVKERLLLELQAKNAQSTSKDLRGESER
RESEVPTDEYRSAEELQSSLDEDVFTFESQRESSLEDNEEAKMKSDDKDDEKEISEMFTR
QRSQQDSSRDLKKDSKKDVTDYEIEEVTADHPEVLSIINETVKMAKNMNFEQPHEKIAEI
LDEVLQEVVEENKNRFYGAPKYGGWILDNCPLVKELWMVLVDKGVLPDLVICLSDTENNG
KYLYNRLYLENKQEIDSKILERLLDELLKERKEEEAARKVKEEALRIEEENRKLLEAMTA
KAKEEAEAEAFEDFEVEESELHEGSETPEVAEETRGFLPEESDIFEAPETEHESVSEPPE
DATVGAEFPKGSREGLETKELPETVLLPEFPEDGYPDVPEMDSIRENVSSFYAAWRQMET
AISDSFTQILNLEIAGKTPEELLQKVIEIMEKPFHHAAWELTIEDYDEETEDYQAEADVD
EELEEEEEEEEENEDIIKEKRRHLGDTKHFCPVALKENFVLQPGTPEEAAKYREKIYYFS
SPEAKEKFLEQPEEYVAHDEPLKAPPLRICLLGPHGSGKTVCGRQLAEKLGIFHIQFEEF
LQEKLMLKTEKKVGPEFEDDSEDEQFVKQELEELAIQANVTIEEENTKKLPQEVQLTEEE
EAIRLNLTENEPLPLEILEAILSEWWFKEPICSTGFVLDGFPRYPDEVQFLGEHGLFPDA
AVFIQVDDQDISDRLLPVQIGKWKAKQKKKLERKKLIKEMKAKIKDDMIAKRRAELITER
EKRRKGGVTVREDEDMSEEEPDNNEDDIDNILEDEFPKDEEVMSEEEEEQEIDALERLRG
ELGEKFEADMSNLQIIQEEFEKFLIPVILINGSRKIHIVQYTLNTKLKPLVENRASIFEK
CYPISSRLAQKMLSFTYKYISSFGYWDPVKLHEGETIKPVENSENPLHPVIHRQYIYFLS
SKETKEKFMKNPIKYICQPKPKPTIPIRIAILGPPKSGKTTVAKKISSEYGLKRLSIGDA
LRYVLNNQPDTELALMLNWHLHKGMTAPDELAIQALELSLMGSVCNTAGVVIDGYPVTKY
QVSLLEARSIIPMIIFELDVPSKEIFRRLLLEKKKESSLPYPLHNSSQIIAVKNSRYRKN
IGEIRQYYEVQHQNWYVIDGFHSKWWIWNEVIKKVKMVNKYMQIYMERIKAGKAACIDKL
CISPEELISRLGEFGQFCPVSLAESYELVDCSSNDSLEFAAEFRGHYYKMSSLEKLNKFL
DNPEFYVPPLAPHPLPPTDMIPKRLTLSELKSRFPKCAELQGYCPVTYQDGRQRYEALVP
GNIHYALEYRDRIYICESREKLQKFLRSPQKYWNQKLPYKLPPLKEPMSLTSLPLPGYLE
QGIATALIKAMNAAGCLKPKFPFLSVRRSALLYIALHLKAFNPNSSEYTRKKYKKKMEQF
VERCELITYLSAKMTKKYKEPQFRAIDFDHKLQTFLSLRNIDPVNG
NT seq 5721 nt NT seq  +upstreamnt  +downstreamnt
atgacttctcaagagaagacagaaaagcatccttttgcggatatatttaatgaagatgaa
gctgacataaactttatgttgtctaaacctgtttgctttgttgtatttgggaaaccaggg
gttgggaagacaacattagcccaacagataacacaggcatggaaatgtattcgtgtagaa
gctttaccaattttggaagaacagattgccagtgacactgtaacgggagctatgttgcag
tcaatgctgatcagtggccaaagcattccagatgaacttgtcacaaagttaatgttggat
aagctgaactcctcagaagtctctcactttggctatattatcactgaaataccatcactt
tcacaggatgccatgactactctgcagcaaatagaattaattagaaatttaaaattgaaa
cctgatattataatcaatattaagtgccctgactatgatttatgccaaagaatttcgggg
caaaggcagcacagtaccacaggatacatatacacaagagatcagtgggatcctgaagtc
attgagaatcgtaggaaaaagaagaaagaagcccaaaaggaaggaaaaggagaagaggag
ggggaagaggaagaagagcaagaagaagaagaggcatttattgctgaaatgcagatagtg
gctgaagttcttcaacacctcgttcagagacctgaggattatttggaaaatatcgaacac
atcgttaacctttataaggaaataattcttcatcctttagaagaagtaatggctgaacat
gattcccagtatctcattgagctagatggaaataagcccccagaggagctgttcatgacg
gttatggatcgacttaaatatctaaacctaaaaagagcagctgttataaccaaacttcag
agtacagaggaagatattaatgacacaatggaaaatgatgagctgttccgtactctcgca
tcttataaacttattgcaccaagatatagatggcagagaagccgatggggacgtacatgt
cctgtgactttaaaagaaggtaacatttttcaaggattgccagatttttctgtgagtttt
ctaggtaaaatgtactgtctttcatcagaagaggcattaaaaacatttctattgaaccca
cgtccctatcttattccacctatgccagcaccaccatttaaagtattcatatttggacct
cagtcttcagggaaaacaacacttagcaatttgcttgcaaaacattacaaaggaaaggta
gttgactatgataaagtgattcaaccacgttttgataaagcccttgaaatgttaaccaga
aacactatagctgaggccactgaagcagccattaaagttgtcaaagaacggcttctctta
gaactacaagctaaaaatgctcagtcaacttcaaaagaccttcgaggagaatctgaaagg
agggaaagtgaagtcccaactgatgaatacagaagtgcagaagaattgcagtcgtcactt
gatgaagatgtgttcacttttgaatcccaaagagaaagctctttagaagacaatgaagaa
gccaaaatgaagtcagatgataaagatgatgaaaaagaaataagtgaaatgtttacacgt
caaagaagtcagcaagactctagtcgagatctaaagaaggattccaaaaaagatgtaaca
gactatgagatagaagaggtaactgctgatcatccagaagttctttccataataaatgag
acagtaaaaatggcaaagaatatgaactttgaacagccacatgaaaaaattgctgagatc
ttagatgaagttctgcaagaggtagttgaagaaaacaagaataggttttatggtgccccc
aaatatggaggatggatactggacaactgccctcttgtgaaagaactctggatggtctta
gtcgacaaaggagttctacccgatttagtcatctgtttatcagacacagaaaacaatgga
aaatatttatataatagactgtatttagagaataaacaagaaattgactctaagatttta
gaaagattattagatgaactactaaaggaaagaaaagaggaagaagcagcaagaaaagtc
aaggaagaggcattaagaatagaagaagaaaatcgaaagctattggaagctatgactgca
aaagcaaaagaagaagctgaagccgaggcttttgaggattttgaagttgaggagtctgaa
cttcacgaagggtctgagacccctgaggttgctgaggagaccagggggttcttacccgag
gagtctgacatttttgaggccccagaaacagaacatgaatcagtatctgagcctcctgag
gatgctacagtcggagcagaatttccaaaaggatccagagagggcctggaaactaaagaa
ttacctgaaacagttctactacctgaatttccggaagatggttatcctgatgttcctgaa
atggattcaattagagagaatgtcagctctttctacgctgcctggagacagatggaaaca
gctatcagtgactcttttactcaaattttaaacctggagattgctggcaaaactccagag
gaactacttcaaaaagtcattgaaattatggaaaaaccctttcaccatgctgcttgggag
ttaactatagaagattatgatgaagaaacagaagactatcaggctgaagccgatgtcgat
gaggagctagaagaggaagaagaggaagaggaagagaatgaagatataattaaggagaag
agaaggcatttgggagatacaaagcacttttgtccagtggctctcaaagaaaacttcgtc
ctacaaccaggcaccccagaagaagcagctaaataccgagaaaagatctattacttttca
agtcctgaagctaaagaaaagtttttggagcagcctgaagagtatgtggctcatgatgaa
ccattaaaggctccgccattaagaatatgccttctcggcccccatggctctggcaaaact
gtctgtggaagacagctggcagaaaaattgggcatttttcatattcagtttgaagaattt
cttcaagaaaaactaatgctcaaaactgaaaagaaagtgggacctgaatttgaggacgat
tctgaggatgaacaatttgtaaaacaagaacttgaagagcttgcaattcaggccaatgtt
acaattgaggaagaaaatacaaagaagctgcctcaggaagtgcaacttacagaagaagaa
gaagcaatcagattaaacctaactgaaaatgagccattgcctcttgaaatccttgaagca
attctttctgagtggtggtttaaggaaccgatatgttctacaggttttgtattagacggt
ttcccgcggtatccagatgaggtccagttcctgggggaacatgggcttttcccagatgct
gctgtgtttatacaagttgatgatcaagatatttctgatcgcctccttcctgtccaaatt
ggaaagtggaaagcaaaacaaaagaagaaattagaaaggaaaaaactcatcaaagaaatg
aaggcaaaaatcaaggatgatatgattgctaaaagaagggctgaacttataacagagaga
gaaaaaaggaggaaaggaggggtgactgttagagaagacgaagacatgagtgaggaagaa
cctgataacaatgaagatgatattgataacattctcgaagatgaatttccaaaagatgag
gaagtgatgagtgaggaagaggaagagcaggaaattgatgctctcgaacgcctgaggggt
gaactcggagaaaaatttgaagcagatatgagtaatttacaaataatacaggaagaattt
gagaagtttttgataccagtaattctcattaatggatctcggaaaatccacattgtccaa
tacacattgaatacaaaactgaaaccactagtagagaatcgtgcaagcatttttgagaaa
tgttatccaatatcatcacgccttgcccagaaaatgctcagctttacctacaagtatata
agctcattcggctactgggaccctgtaaagctacatgaaggagagaccatcaaaccagta
gaaaattcagagaatccacttcatcctgtaatccatcgtcagtatatttattttttatct
agtaaagaaactaaagaaaaatttatgaagaatccaatcaaatatatctgtcaacccaaa
cctaagcctactatccccattaggattgcaattctggggcctccaaaatctggaaaaact
acagttgccaaaaagatttcaagtgaatatggcttaaagcgtttgtcgataggagatgct
ttgcgttatgtattaaacaaccaaccagacacagagctggcacttatgctaaattggcat
cttcataaaggaatgacggcacctgatgaactggctattcaggccttagaattatctctg
atgggaagtgtatgtaataccgcaggtgttgtcattgatggatatcctgtaactaagtat
caagtgagtctcttagaagctaggtcaatcatccccatgattatctttgagctggatgtg
ccttccaaagagattttcagaagattgctcctggaaaaaaaaaaggagtcaagtttgcct
tatccattgcacaacagctcacagattatagctgtcaagaactcaaggtaccgcaaaaat
attggtgagattaggcaatattatgaagtacaacatcagaactggtatgtgattgatggc
tttcacagcaaatggtggatatggaatgaagtcattaagaaggttaaaatggtgaataaa
tacatgcagatatatatggaaagaataaaagcaggaaaagccgcctgcattgacaagtta
tgtatctcccctgaagaactgatttctcgcctgggtgaatttggacagttctgccctgtc
agcctggcagaatcatatgaattagttgattgttcttcaaatgattccttggaatttgca
gcagagttcagagggcactattataaaatgagttctctagagaaattgaataaatttttg
gacaatccagaattctacgtacctccgttagcacctcatccacttccacctaccgacatg
atccccaagaggctgacactgtcagagctgaagagccggttccctaagtgtgctgagctc
cagggttactgtccagtgacttaccaggatggcagacaaagatacgaagccctagtacct
ggtaacattcactatgctttagaatatcgtgatcgtatatatatttgtgagagcagagaa
aaacttcagaaatttttgaggtcaccacagaaatactggaatcagaagcttccttacaaa
cttcccccattgaaggaaccaatgtctctcaccagcctgcctttgcctggatatctggaa
cagggtattgcaactgctctaattaaagccatgaatgcagcgggatgcttaaagcccaaa
ttccccttcttaagtgtacggagatctgcgctactttatatagcacttcatctgaaagcc
tttaatcccaatagttctgaatatacaagaaaaaaatacaagaagaagatggagcagttt
gtggagagatgtgaactcattacatacttgagtgccaagatgaccaagaaatacaaggaa
cctcagtttagagccattgactttgatcataaattacagacctttctctctcttagaaat
atagacccagtcaatggttag

DBGET integrated database retrieval system