KEGG   Bos taurus (cow): 504599
Entry
504599            CDS       T01008                                 

Definition
(RefSeq) histone H3.2
  KO
K11253  histone H3
Organism
bta  Bos taurus (cow)
Pathway
bta04613  Neutrophil extracellular trap formation
bta05034  Alcoholism
bta05202  Transcriptional misregulation in cancer
bta05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    504599
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    504599
  09163 Immune disease
   05322 Systemic lupus erythematosus
    504599
  09165 Substance dependence
   05034 Alcoholism
    504599
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bta03036]
    504599
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    504599
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    504599
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   504599
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 504599
NCBI-ProteinID: NP_001160041
BGD-bta: BT23997
Ensembl: ENSBTAG00000032452
UniProt: P84227
Position
3
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcgcgtacgaagcagaccgcccgcaagtcgaccggtggcaaggccccgcggaagcag
ctggccaccaaggcggctcgcaagagcgcgccggccacgggcggcgtcaagaagccgcat
cgttataggccgggcaccgtggccctgcgggagattcggcgctaccagaagtcgaccgag
ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggactttaag
accgatctgcgcttccagagctcggccgtgatggcgctgcaggaggcgagcgaggcctac
ctggtggggctgtttgaagacacgaacctgtgcgccatccacgccaagcgcgtgaccatc
atgcccaaagacatccagctggctcgtcgcatccgcggggagcgggcttaa

DBGET integrated database retrieval system