KEGG   Bos taurus (cow): 504701
Entry
504701            CDS       T01008                                 

Gene name
SGTA
Definition
(RefSeq) small glutamine-rich tetratricopeptide repeat-containing protein alpha
  KO
K16365  small glutamine-rich tetratricopeptide repeat-containing protein alpha
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    504701 (SGTA)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   504701 (SGTA)
SSDB
Motif
Pfam: TPR_1 SGTA_dimer TPR_8 TPR_2 TPR_11 TPR_17 TPR_7 TPR_14 TPR_10 TPR_16 TPR_12 TPR_19 TPR_9 TOM20_plant NARP1 TPR_6 BTAD DUF627 STI1
Other DBs
NCBI-GeneID: 504701
NCBI-ProteinID: NP_001033119
BGD-bta: BT24256
Ensembl: ENSBTAG00000015090
VGNC: 34553
UniProt: Q32LM2
Position
7
AA seq 313 aa
MDNKKRLAYAIIRFLHDQLRHGELSSDAQESLEVAIQCLETAFGVTVEDSDLALPQTLPE
IFEAAAAGKELPPDLRSPQETPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIEL
NPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPSYSKAYGRMGLALSSLNKHTEAVA
YYRKALELDPDNETYKSNLKVAELRLREAPSPTGGVGSFDIAGLLNNPSFMSMASNLMNN
PQVQQLMSGMISGGHNPLGTPGTSPSQNDLASLIQAGQQFAQQMQQQNPELIEQLRSQIR
SRTPSASNDDQQE
NT seq 942 nt   +upstreamnt  +downstreamnt
atggacaacaagaagcgtctggcctacgccatcatccgcttcctgcacgaccagctccgg
catggggagctctcgtctgatgcccaggaaagcctggaagttgccatccagtgcctggag
accgcttttggggtgacggtggaggacagtgacctcgcgctcccccagactcttccggaa
atatttgaagcagctgccgcgggcaaggagctgccgccagatctgaggagcccccaggaa
accccgccttcggaggaggactcggccgaggcagaacgcctcaaaactgaaggaaatgag
cagatgaaagtagagaacttcgaggccgctgtgcacttctatgggaaagccatcgagctg
aaccctgccaatgccgtctacttctgtaacagagccgcagcctacagcaaactggggaac
tatgcaggggcagtgcaggactgcgagcgggccatctgcatagacccgtcctacagcaag
gcctatggcagaatgggcctggcactatccagcctgaacaagcacacggaggccgtggcc
tactacagaaaggccctggagctggatccagacaatgagacctacaagtccaacctcaag
gtggctgagctgcggctgagagaggcacccagtcccacgggaggtgttggcagctttgac
atcgcaggcctcctgaacaacccgagcttcatgagcatggcatcaaacctgatgaacaat
ccccaggttcagcagctcatgtctggcatgatttcgggcggccacaaccccctggggact
cccggcaccagcccctcgcagaatgacctggccagtctcatccaggcgggccagcagttt
gctcagcaaatgcagcaacagaacccagagttgatagagcagctccgcagtcagatcagg
agtcggactcccagtgccagcaacgacgaccagcaggagtag

DBGET integrated database retrieval system