KEGG   Bos taurus (cow): 504764Help
Entry
504764            CDS       T01008                                 

Gene name
GRHPR
Definition
(RefSeq) glyoxylate reductase/hydroxypyruvate reductase
  KO
K00049  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
bta  Bos taurus (cow)
Pathway
bta00260  Glycine, serine and threonine metabolism
bta00620  Pyruvate metabolism
bta00630  Glyoxylate and dicarboxylate metabolism
bta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    504764 (GRHPR)
   00630 Glyoxylate and dicarboxylate metabolism
    504764 (GRHPR)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    504764 (GRHPR)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     504764 (GRHPR)
    1.1.1.81  hydroxypyruvate reductase
     504764 (GRHPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored KR Shikimate_DH XdhC_C ThiF
Motif
Other DBs
NCBI-GeneID: 504764
NCBI-ProteinID: NP_001178966
BGD-bta: BT20975
Ensembl: ENSBTAG00000019299
VGNC: 29637
UniProt: F1MB84
Position
8
AA seq 328 aa AA seqDB search
MRPVRLMKVFITRRIPPEGSAALARAADCEVEQWDSDEPIPREDLEQRMAGAQGLLCLLS
DRIDKKLLDAAGANLKVISTMSVGVDHLALDEIKKRGIRVGYTPGVLTDATAELAVSLLL
TTCRRLPEAIEEVKNGGWTSWKPLWMCGHGLSQSTVGIVGLGRIGQAIARRLKPFGVRRF
LYTGRQPRPQEAAEFQAEFVSTPKLAAESDFIVVACSLTPATRGLCNKDFFQWMKKTAVF
VNISRGEVVDQDDLYQALASGQIAAAGLDVTTPEPLPTNHPLLTLKNCVILPHIGSATHR
TRNIMSVLAADNLLAGLRGEPMPSELKL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaggccagtgagactcatgaaggtgttcatcacacgcaggattccccccgagggcagc
gccgcgctcgcccgggccgcagactgtgaggtggagcagtgggattctgatgagcccatc
cccagagaggacctggaacagagaatggctggggcccagggcctgctctgcctcctctcg
gaccgcatagacaagaagctcctggacgctgcaggagctaatctcaaagtcattagcaca
atgtctgtaggtgtcgaccacttggctttggatgaaatcaagaagcgtgggatccgtgtg
ggctacactccgggtgtcctgacagacgccacggccgagctcgccgtctccctgctgctt
accacttgtcgccggttgccggaggccatcgaggaggtgaagaacggtggttggacctca
tggaaacccctgtggatgtgtggccacggcctttcacagagcaccgtcggcatcgttggc
ctggggcgcataggccaggccattgctcggcgtctgaaaccattcggtgtccggagattt
ctatacacagggcgccagcccaggcctcaggaagcagcggaatttcaggcagagtttgtg
tccacccccaagctggccgccgagtccgatttcatcgttgtggcctgctccttaacaccg
gcgaccagggggctctgcaacaaggacttcttccagtggatgaagaaaacagctgtgttt
gtcaacatcagcagaggagaagtggtagaccaggatgacctgtaccaggccctggccagc
ggtcagattgcagctgccggactggacgtgacgaccccagaaccactgcctaccaaccac
cctctcctgaccctgaagaactgtgtgatcctgcctcacattggcagtgccacccacagg
acccgaaacatcatgtctgtcttggcagctgacaacctgctggctggcctgcgaggggag
ccgatgcccagtgaactcaagctatag

DBGET integrated database retrieval system