KEGG   Bos taurus (cow): 505183Help
Entry
505183            CDS       T01008                                 

Definition
(RefSeq) histone H2B type 1
  KO
K11252  histone H2B
Organism
bta  Bos taurus (cow)
Pathway
bta05034  Alcoholism
bta05203  Viral carcinogenesis
bta05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    505183
  Immune diseases
   05322 Systemic lupus erythematosus
    505183
  Substance dependence
   05034 Alcoholism
    505183
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    505183
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   505183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 505183
NCBI-ProteinID: XP_002697561
BGD-bta: BT15959
Ensembl: ENSBTAG00000031770
UniProt: P62808
Position
23
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccagctaagtccgctcctgctcctaaaaagggctctaaaaaggcggtgact
aaggcccagaagaaggatggcaagaagcgcaagcgtagccgcaaggagagctactccgtg
tacgtgtacaaggtgctgaagcaagtccatccggataccggcatctcttccaaggccatg
ggcatcatgaactccttcgtcaacgacatctttgagcgcatcgcgggcgaggcgtctcgc
ctggcacattacaacaagcgctccactattacatccagggagatccagaccgcagtgcgt
ctgctgctgcccggggagctggccaagcatgcggtgtctgagggcaccaaggctgtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system