KEGG   Bos taurus (cow): 505290Help
Entry
505290            CDS       T01008                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
bta  Bos taurus (cow)
Pathway
bta00561  Glycerolipid metabolism
bta01100  Metabolic pathways
bta04714  Thermogenesis
bta04723  Retrograde endocannabinoid signaling
bta04923  Regulation of lipolysis in adipocytes
Module
bta_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    505290 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    505290 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    505290 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    505290 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bta01002]
    505290 (MGLL)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     505290 (MGLL)
Peptidases [BR:bta01002]
 Serine Peptidases
  Family S33
   505290 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 Abhydrolase_5 LIDHydrolase BAAT_C Abhydrolase_3 DUF1350 Thioesterase PGAP1
Motif
Other DBs
NCBI-GeneID: 505290
NCBI-ProteinID: NP_001193610
BGD-bta: BT14456
Position
22
AA seq 303 aa AA seqDB search
MPEERPPRLTPQNVPYQDLPHLVNADGQHLFCRYWRPLSAPRALVFVSHGAGEHCGRYDE
LAQMLVGLGLLVFAHDHVGHGQSEGERMVVSDFHVFIRDVLQHVDAVQKDYPGLPVFLLG
HSMGGAICILTAAERPGHFSGMVLISPLVVANPESATLFKVFAAKVLNLVLPNMSLGRID
SSVLSRNKTEVDIYNTDPLVCRAGLKVCFGNQLLNAVSRVERALPKLTLPFLLLQGSADR
LCNSRGAYLLMESAKSQDKTLKIYEGAYHILHKELPEVTSSVFREINTWVSQRTAVEGMG
CPP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggaacgtccccccaggctgaccccgcagaacgttccctaccaggacctccct
cacctggtcaacgctgacgggcagcacctcttctgccggtactggagacccttgagcgcg
cccagggccctggtgttcgtgtcccacggagctggcgagcactgcggccgctacgacgag
ctggcgcagatgctggtggggctgggcctgctggtcttcgcccacgaccatgtcggccac
gggcagagcgagggcgagaggatggtggtgtccgacttccacgtcttcatccgggatgtg
ctccagcacgtggacgccgtgcagaaggactacccggggctgcctgtcttcctcctcggc
cactccatgggcggcgcgatctgcatcctcacggccgcggagaggccgggccacttctcg
ggcatggttctcatttccccgctggtcgtcgccaatccagagtcggcgacacttttcaag
gtcttcgctgcgaaagttctgaacctcgtcctgccaaacatgtccctgggccggatcgac
tccagtgtgctctcgaggaataagacggaggtggacatctacaacacggaccccctggtc
tgccgggcggggctcaaagtctgcttcggcaaccagctgctcaacgcggtgtcgcgggtg
gagcgggcgctgcccaagctgacactgcccttcctgctgctgcagggctctgccgaccgc
ctctgcaacagcaggggcgcctacctgctcatggagtcagccaagagccaggacaagacg
ctcaagatttacgaaggtgcctatcacatcctccacaaagagcttcctgaggtgaccagc
tctgtcttccgggagataaacacgtgggtctcgcaaaggacagcggtggagggaatgggg
tgcccaccctga

DBGET integrated database retrieval system