KEGG   Bos taurus (cow): 505472
Entry
505472            CDS       T01008                                 

Gene name
PYGL
Definition
(RefSeq) glycogen phosphorylase, liver form
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
bta  Bos taurus (cow)
Pathway
bta00500  Starch and sucrose metabolism
bta01100  Metabolic pathways
bta04217  Necroptosis
bta04910  Insulin signaling pathway
bta04922  Glucagon signaling pathway
bta04931  Insulin resistance
Module
bta_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    505472 (PYGL)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    505472 (PYGL)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    505472 (PYGL)
   04922 Glucagon signaling pathway
    505472 (PYGL)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    505472 (PYGL)
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     505472 (PYGL)
SSDB
Motif
Pfam: Phosphorylase
Other DBs
NCBI-GeneID: 505472
NCBI-ProteinID: NP_001068671
BGD-bta: BT15225
Ensembl: ENSBTAG00000011494
VGNC: 33588
UniProt: Q0VCM4
Position
10
AA seq 851 aa
MAKPLTDQEKRRQISIRGIVGVENVAELKKGFNRHLHFTLVKDRNVATPRDYFFALAHTV
RDHLVGRWIRTQQYYYEKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDM
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQIEEA
DDWLRHGNPWEKARPEFMLPVHFYGRVEHTEAGTKWTDTQVVLALPYDTPVPGYLNNTVN
TMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDVIRRFKASKFDSSNSTKTAFDAFPDQVAIQLNDTHPSLAIPELMRIFVDIEKL
PWSKAWEITQKTFAYTNHTVLPEALERWPVELVEKLLPRHLQIIYEINQKHLDKIAALFP
KDVDRLRRMSLIEEEGGKRINMAHLCIVGSHAVNGVAKIHSDIVKTQVFKDFSELEPDKF
QNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLNSFLGDDIFLREISNVKQ
ENKLKFSQFLEKEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVVTMYNRIKKDPKKLFV
PRTVIIGGKAAPGYYMAKLIIKLITSVAEVVNNDPVVGSKLKLIFLENYRVSLAEKVIPA
TDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIEDVA
ALDKKGYEAKEYYEALPELKLAIDQIDKGFFSPKQPDLFKDLVNMLFYHDRFKVFADYEA
YVKCQEKVSQLYMNPKAWNIMVLKNIAASGKFSSDRTIKEYARDIWNMEPSDIKISLSSD
PSGGANKANGK
NT seq 2556 nt   +upstreamnt  +downstreamnt
atggccaagcccctgaccgaccaggagaagcggcggcagatcagcatccgcggcatcgtg
ggcgtggagaacgtggccgagctgaagaagggcttcaatcggcacctgcacttcactctg
gtcaaggaccgcaacgtggccaccccccgcgactacttcttcgcgctggcgcacacggtg
cgcgaccacctagtagggcgctggatccgcacgcagcagtattactacgagaagtgcccc
aagagggtttattacctctctttggaattttacatgggccgaacattacagaacaccatg
atcaaccttggcctgcagaatgcctgtgatgaggccatctaccagcttggattggatatg
gaggagttagaagaaattgaagaagatgctgggcttggcaatggtggtcttgggaggctt
gctgcctgcttcctggattccatggcaactctggggcttgcagcctatggctatggcatc
cgatatgaatatggaatcttcaatcagaagattcgagatggatggcagatagaagaagca
gatgattggctcaggcatggaaacccctgggagaaggcccgccctgagttcatgctgcct
gttcacttctatggaagagtagagcacacagaggctgggaccaaatggaccgacacccag
gtggtcctggccctcccgtatgacaccccggtgcctgggtacctgaacaacacggtcaac
acgatgcgcctctggtccgctcgggcgcccaatgacttcaacctcagagactttaacgtt
ggagactacattcaggccgtgctggaccggaatctggccgagaacatctcccgggtcctc
tatcccaatgataatttttttgaagggaaggagctaagattgaagcaggagtattttgtg
gtagctgctaccttgcaagatgtcatccgacgtttcaaagcctccaagtttgactccagc
aatagcaccaaaactgcgttcgatgccttcccagatcaggttgccatccagctgaatgac
acccacccttcacttgccatccctgagctgatgaggatttttgtggatattgaaaaactg
ccctggtccaaggcatgggagatcacccagaagaccttcgcctacaccaaccacacggtg
ctcccagaagccctggagcgctggcctgtagagctggtggagaagttgcttcctcgacat
ttgcaaatcatttacgagataaatcagaagcacttagataaaattgctgccttgtttcct
aaagatgtcgaccgtctgagaaggatgtctctgatagaagaggaaggaggcaaaaggatc
aacatggcccatctctgcattgtgggctcccacgctgtgaacggcgtggctaaaatccac
tcggacatcgtgaagacccaagtattcaaggactttagtgagctagaaccagacaagttt
cagaataaaaccaatgggatcactccaaggcgctggctcttactctgcaacccggggctg
gcagagttaatagcagagaaaatcggggaggactacgtgaaggacttgagccagctgacg
aagctgaacagcttcctgggcgacgacatcttcctccgcgagatctccaacgtgaagcag
gagaacaagctgaagttttctcagttcctggagaaggagtacaaagtgaagatcaacccg
tcctccatgttcgacgtgcaggtgaagcggatccatgagtacaagcgacagctcctgaac
tgcctgcacgtggtcaccatgtacaaccgcattaagaaagacccaaagaagctattcgtg
cccagaacagttataatcggtggcaaagctgcccctggatactacatggccaaacttatc
ataaagctgatcacatcagtggcagaggtggtgaacaatgaccctgtggttggaagcaag
ttgaaactcatcttcctggaaaactacagagtgtctcttgcggaaaaagtcattccagcc
acagatctgtcggagcagatttccactgcaggcaccgaagcctcagggacaggcaacatg
aagttcatgctgaatggggccctgaccattgggaccatggatggggccaacgtggaaatg
gctgaggaagccggggaagagaacctgttcatctttggcatgagaatagaggacgtggct
gctttggacaagaaagggtatgaggcaaaagaatattatgaggcacttccagagctgaag
ttggccattgatcaaattgacaagggctttttttctcccaagcagcctgacctcttcaaa
gacttagtcaacatgctgttttatcatgacaggtttaaagtttttgcagactatgaagcc
tacgtcaaatgtcaagaaaaagtcagccagctgtacatgaatccaaaggcctggaacatc
atggtcctcaaaaatatagccgcctcggggaaattctccagtgaccgaacgattaaggag
tatgcccgggacatctggaacatggagccttctgacataaagatttccctgtccagtgac
cccagcggtggggcaaacaaagccaatggaaagtaa

DBGET integrated database retrieval system