KEGG   Bos taurus (cow): 505545Help
Entry
505545            CDS       T01008                                 

Gene name
BSDC1
Definition
(RefSeq) BSD domain-containing protein 1 isoform a
Organism
bta  Bos taurus (cow)
SSDB OrthologParalogGFIT
Motif
Pfam: BSD
Motif
Other DBs
NCBI-GeneID: 505545
NCBI-ProteinID: NP_001030198
BGD-bta: BT28931
Ensembl: ENSBTAG00000020655
VGNC: 26578
UniProt: Q3SX22
Position
2
AA seq 462 aa AA seqDB search
MMEPGGDGAEDDVGAGIGPPAPGWCLRGRCRVGSQREDVGWWRSWLQQSYQAVKEKSSEA
LEFMKRDLTEFTQVVQRDTACTIAATASVVKEKLTTEGSSGATEKMKKGLSDFLGVISDT
FAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYCNEPDGPPELFDAWLS
QFCLEEKKGEISELLVGSPSIRALYTKMVPAAVSHSEFWHRYFYKVHQLEQEQARRDALK
QRAEQSISEEPGWEEEEEELAGVSPTSLKEAKVPVARPSTSPEGGPGPQSPCEENLVTPV
EPPTEVTPSESSESVSLVTQIAKPPPASEAPALPKDLSQKLLEASLEEQDLAVDTGETGP
PPRAQSKPHTPACRPSGPEPRPPARVETLREEILTDLRVFELNSDSGKSTPSNNGKKGSS
TDISEDWEKDFDLDMTEEEVQMALSKVDASGELEDVEWEDWD
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgatggagccaggcggagacggggctgaggacgatgtcggcgcggggattgggcctccc
gctccggggtggtgcttgagggggcggtgccgtgtcggaagtcaaagggaggacgtggga
tggtggcggagctggctgcagcagagctaccaggcagtcaaggagaagtcctccgaagcc
ctggagttcatgaagcgggacctgacggagttcacccaggtggtgcagcgcgacacggcc
tgcaccattgcggccaccgccagcgtagtcaaggagaagctgactactgaaggctcctct
ggagcgacagagaaaatgaagaaagggctgtctgacttcttgggggtgatctccgatacc
tttgccccctcaccagacaaaaccatcgactgtgacgtcatcaccctgatgggcacgcct
tctgggacggctgagccctatgatggcaccaaggctcgcctctatagcctgcagtcagac
ccagcaacctactgcaatgaaccagatgggcccccagagttgtttgatgcctggctttcc
cagttctgcttggaggagaagaagggggagatctcagagctccttgtaggcagcccctcc
atccgggccctctacaccaagatggtgcctgcagctgtttcccattcagaattctggcat
cggtatttctataaagtccatcaactagagcaggagcaggcccggagggatgccctgaaa
cagcgggcagaacagagcatctctgaagagcctggctgggaggaggaagaagaggagctt
gcaggcgtttcacccacgtccctaaaagaggcaaaggttcctgtggccagaccttccaca
tcccctgaaggaggacctggtccccagagcccctgtgaagagaatctggtgacccccgtc
gagcctccaacagaggtgaccccctcggagagcagtgagagcgtctccctggtgacacag
attgccaaaccgccccctgcctctgaggccccagcgctgcccaaggacctgtcccagaag
cttctagaggcatctttggaggaacaggacctggctgtggatacgggcgagactggaccc
ccaccccgagctcagtccaagccccacacccctgcttgccgccccagcggtccagagccc
cggcctccagccagagtagagactctcagggaagagatcctcacagacttacgggtgttt
gagctgaactcggacagtgggaagtctacaccctccaacaatgggaaaaaaggctcgagc
acagacatcagtgaggactgggagaaggactttgacttggacatgactgaagaagaagtg
cagatggcactttccaaagtggatgcctccggtgagctggaagacgtagagtgggaggac
tgggattga

DBGET integrated database retrieval system