KEGG   Bos taurus (cow): 505722Help
Entry
505722            CDS       T01008                                 

Gene name
TCEA1
Definition
(RefSeq) transcription elongation factor A protein 1
  KO
K03145  transcription elongation factor S-II
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bta03021]
    505722 (TCEA1)
Transcription machinery [BR:bta03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription elongation factors
     505722 (TCEA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_M TFIIS_C Med26 DBD_Tnp_Mut Ku_C
Motif
Other DBs
NCBI-GeneID: 505722
NCBI-ProteinID: NP_001039390
BGD-bta: BT14857
Ensembl: ENSBTAG00000003460
VGNC: 35679
UniProt: Q29RL9
Position
14
AA seq 301 aa AA seqDB search
MEDEVIRIAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQSTDE
EVTSLAKSLIKSWKKLLDGPSTDKDSEEKKKDTAVTSQNSPEAREESSSSGNMSSRKDET
NARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIAIGADEEELGSQIEEAIYQEI
RNTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNL
TKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKF
C
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgaggtgatccgcattgccaagaagatggacaagatggtgcagaagaagaac
gcggctggagcattggatttactgaaggagcttaagaatattcccatgaccctggaacta
ttacagtccacaagaattggaatgtcagtgaatgctattcgcaagcagagcacagatgaa
gaagttacatctttagcaaagtccctcatcaaatcctggaaaaagttattagatggacca
tcaacagataaagactctgaagaaaagaaaaaagatactgcagttacgtcacagaatagc
cctgaagcaagagaggaaagcagctccagtggcaacatgagcagcagaaaggacgagacc
aatgcccgggacacgtacgtctcatcttttcctcgggcgccgagcacttctgattctgtg
cggttaaagtgcagggagatgctcgctgctgctctccgaacaggagatgactatatcgcc
attggagctgacgaggaagaattgggatctcagattgaggaagctatctatcaagaaata
aggaacacagacatgaaatacaaaaatagagtacgaagtaggatatcaaatcttaaggat
gccaaaaatccaaatttaaggaaaaacgtgctgtgtgggaacattcctcctgacttgttt
gctagaatgacagcagaggagatggctagtgatgagctcaaagagatgcggaaaaacttg
accaaagaagccatcagagagcatcagatggccaagacaggcggaacccagacggacttg
ttcacatgcggcaaatgtaaaaagaagaactgcacttacacacaggtacaaacacggagt
gctgatgaacccatgacaacgtttgtcgtctgcaacgagtgtggaaaccggtggaagttc
tgttga

DBGET integrated database retrieval system