KEGG   Bos taurus (cow): 506066Help
Entry
506066            CDS       T01008                                 

Gene name
SH2B1
Definition
(RefSeq) SH2B adapter protein 1
  KO
K12459  SH2B adaptor protein 1/3
Organism
bta  Bos taurus (cow)
Pathway
bta04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    506066 (SH2B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phe_ZIP SH2 PH
Motif
Other DBs
NCBI-GeneID: 506066
NCBI-ProteinID: NP_001192458
BGD-bta: BT28859
Ensembl: ENSBTAG00000019219
VGNC: 34555
UniProt: F1MJV1
Position
25
AA seq 756 aa AA seqDB search
MNGAPSPEDGASPSPPPLPPPPPPSWREFCESHARAAALDFARRFRLYLASHPQYAGPGA
EAAFSRRFAELFLQHFEAEVARASGSLSPPLLAPLSPGVEVPPHDLSLESCRAGGPLAVL
GPSRSSEDLAGPLPSSVSSSSTTSSKPKLKKRFSLRSVGRSVRGSVRGILQWRGTVDPPS
PAGPLETASGPPALGGNSNSNSSGGAGTVSRGLVSDGTSPGDRWTHRFERLRLSRGGGAL
KDGAGVVQREELLSFMGAEEAAPDPAGVGRGGGAAGPTSGGGGQPQWQKCRLLLRSEGEG
GGSRLEFFVPPKASRPRLSIPCSTITDVRTTTALEMPDRENTFVVKVEGPSEYILETADA
LHVKAWVSDIQECLSPGPYPATSPRPMTLPLAPGTSFLTRENTDSLEPPCLNHLESLPSQ
GLLLGPSESSDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEEG
PPAGTVHPLAAPYPPLDTPETATGSLLFQGEPEGGEGDQPLSGYPWFHGMLSRLKAAQLV
LAGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDML
EHFRMHPIPLESGGSSDVVLVSYVVSSQRQQEPSTSHDPPQPPEPPSWTDPPHPGAEEAS
GAPEVAAAAAAAAKERQEKEKAGSGGIQEELVPVVELVPVVELEEAVAPGTEAQGGAGSA
GAPGVTLMVQLQQLPLGGDGEEGGHPRAINNQYSFV
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtgccccttccccggaggatggggcctcgccctcccctcccccgttgcccccg
ccgcctcccccgagttggcgggagttctgcgagtcccacgcccgggcggccgccctggat
tttgcccgccgttttcgcctctacctggcctctcacccccagtacgcggggccaggggcc
gaggccgccttctcccgccgttttgccgagctcttcctgcagcactttgaagcggaggtg
gcccgggcctccggctccctgtcgccacccctcctggctcctctgagtcctggtgtggag
gtcccgccacacgacctgtcccttgagagctgcagggcgggcgggcccctggctgtgctg
ggcccttctcgctcatctgaggacctggccggccccctcccttcctcggtctcttcctct
tctacaacctcctcgaagccgaagctcaagaagcgcttctctctccgctcagtgggtcgc
tcggtccgcggttcggtccgcggcatcctgcagtggcgggggaccgttgacccgccctct
ccagcggggcccctggagacggcttcgggacccccggctttaggtgggaacagcaactcc
aactcctctggcggggctgggactgtcagcaggggactggtcagcgacgggacatccccc
ggggacagatggactcaccgttttgagaggctgagactcagtcggggagggggggccttg
aaggatggtgcaggcgtggtgcagcgggaagagctgctgagtttcatgggggctgaagag
gctgcccctgatcccgccggagtgggccggggaggaggggcagcggggcctacctcaggg
ggagggggacagcctcagtggcagaagtgtcgcttgctgcttcgaagtgaaggagaagga
ggaggaagtcggctggagttcttcgtaccccccaaggcatctcggcctcgactgagcatt
ccctgctccaccatcaccgacgtgcggacaaccacagccctggagatgcctgaccgggag
aacacctttgtggttaaggtggaaggcccctcggagtacatcctggagacagctgatgcg
ctacatgtgaaggcctgggtgtctgacatccaagaatgcctgagcccgggaccctaccct
gctaccagtccccgccccatgaccctccccctggcccctgggacctccttcctgacaagg
gagaacacagacagcctggagccgccctgcctgaaccacttggagagtctgcccagccag
ggcctgctgctgggacccagtgagagcagcgaccgcctttcgcagggggcctacggaggc
ctgtcagaccgcccctcagcatccatctcccccagttctgcctccatcgccgcctcccat
tttgactcaatggaactgcttcccccagagttgcccccccggatccctattgaagagggt
cccccagcagggaccgttcatcccctcgcagccccttatccacccctggacactccagaa
acagccacagggtccttactgttccaaggcgagccagagggaggcgagggggaccagccc
ctctcagggtatccttggttccatgggatgctttctcgactcaaggccgcccagctagtg
ctggctggaggcactggctcccacggggttttcctggtacgtcagagtgagacaaggcgg
ggtgaatatgtcctcactttcaacttccagggcaaggccaagcacctgcgtctctcgctg
aatgaggaaggtcagtgccgggtccagcacctgtggttccagtccatctttgatatgctc
gagcatttccggatgcaccccatccccctggagtctggaggctccagtgacgttgtcctt
gtcagctatgtcgtgtcctcccagcgacagcaggaaccgagcacctcccatgacccaccc
cagccccctgaacccccttcatggacagatcccccacatcctggggcagaagaggcgtcg
ggggcgccagaagtggcggcagcagcagccgcagcagccaaagagaggcaagagaaagag
aaagcgggcagtggagggatccaggaagagctggtccccgtggttgagctggtccccgtg
gttgaattggaagaggccgtagccccaggcacggaggcccagggaggcgctggatctgct
ggggccccgggggtgaccctgatggtgcagctccagcagttaccactagggggcgacgga
gaagaagggggccatcccagagccataaataaccagtactcctttgtgtga

DBGET integrated database retrieval system