KEGG   Bos taurus (cow): 506107
Entry
506107            CDS       T01008                                 

Gene name
BAG2
Definition
(RefSeq) BAG family molecular chaperone regulator 2
  KO
K09556  BCL2-associated athanogene 2
Organism
bta  Bos taurus (cow)
Pathway
bta04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    506107 (BAG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bta03110]
    506107 (BAG2)
Chaperones and folding catalysts [BR:bta03110]
 Other chaperones and cochaperones
  BAG
   506107 (BAG2)
SSDB
Motif
Pfam: ACDC AAA_13
Other DBs
NCBI-GeneID: 506107
NCBI-ProteinID: NP_001029436
BGD-bta: BT15939
Ensembl: ENSBTAG00000005355
VGNC: 26406
UniProt: Q3ZBG5
Position
23
AA seq 211 aa
MAQARISAKANEGRFCRSSSMADRSSRLLESLDQLELRVEALREAATAVEQEKEVLLEMI
HSIQNSQDMRQISDGEREELNLTANRLMGRTLTVEVSVETIRSPQQQESLKHATRIIDEV
VSKFLDDLGNARSHLMSLYSACSSEVPAGPVDQKFQSIVIGCALEDQKKIKRRLETLLRN
IENADKAIKLLEHSKGAASKTLQQNAEARFN
NT seq 636 nt   +upstreamnt  +downstreamnt
atggctcaggcgaggatcagcgctaaggccaacgagggccgcttctgccgctcctcgtcc
atggccgaccgctccagccgcttgctcgagagcctggaccagctggagctcagggtggag
gctctgcgggaggcggccacggccgtggagcaggagaaggaggtgctcctagagatgatc
cacagcatccagaacagccaggacatgcggcagatcagtgacggagaacgagaagaatta
aatctgactgcgaaccgtctgatgggacgaaccctgactgtggaggtttcagtagaaaca
attaggagtccccagcagcaggagtccctcaagcacgccacgcggatcatcgatgaggtg
gtcagcaagtttctggatgacctgggaaacgcccggagtcacctgatgtcgctgtacagc
gcgtgttcctccgaggtgcctgcggggccggtggaccagaagttccagtccatcgtgatc
ggctgcgctctcgaggaccagaagaaaattaagagacgactagagaccctgcttaggaac
attgaaaacgctgacaaggccatcaagctgctggagcattctaaaggagctgcttccaaa
acgctgcagcagaacgctgaagccagattcaactag

DBGET integrated database retrieval system