KEGG   Bos taurus (cow): 506232Help
Entry
506232            CDS       T01008                                 

Gene name
WDR45B
Definition
(RefSeq) WD repeat domain phosphoinositide-interacting protein 3
  KO
K22991  WD repeat-containing protein 45
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bta04131]
    506232 (WDR45B)
Membrane trafficking [BR:bta04131]
 Autophagy
  Other autophagy associated proteins
   Others
    506232 (WDR45B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC4_WD40 PHTB1_N DUF1513 WD40
Motif
Other DBs
NCBI-GeneID: 506232
NCBI-ProteinID: NP_001068715
BGD-bta: BT23244
Ensembl: ENSBTAG00000003695
VGNC: 36901
UniProt: Q0VD14
Position
19
AA seq 344 aa AA seqDB search
MNLLPCNPHGNGLLYAGFNQDHGCFACGMENGFRVYNTDPLKEKEKQEFLEGGVGHIEML
FRCNYLALVGGGKKPKYPPNKVMIWDDLKKKTVIEIEFSTEVKAAKLRRDRIVVVLDSMI
KVFTFTHNPHQLHVFETCYNPKGLCVLCPNSNNSLLAFPGTHTGHVQLVDLASTEKPPVD
IPAHEGVLSCIALNLQGTRIATASEKGTLIRIFDTSSGHLIQELRRGSQAANIYCINFNQ
DASLICVSSDHGTVHIFAAEDPKRNKQSSLASASFLPKYFSSKWSFSKFQVPSGSPCICA
FGTEPNAVIAICADGSYYKFLFNPKGECVRDVYAQFLEMTDDKL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttctgccctgcaacccgcacggcaacgggctgctctacgccggcttcaaccag
gaccatggatgctttgcatgtgggatggaaaatggattccgagtctataacaccgatcca
ctgaaggaaaaagagaaacaagaatttctagaaggaggagttggtcatattgaaatgttg
tttcgctgcaactatttagctttagttggtggtgggaaaaagccaaaataccctccgaac
aaagtgatgatctgggatgacctgaagaagaaaactgtgattgaaatagaattttctacc
gaagtcaaggctgccaaattacggcgagatagaattgtggttgttttggactctatgatc
aaagtgtttacattcacacataatccccatcagttgcacgtctttgaaacctgctataac
cctaaaggcctctgtgtcctgtgccccaacagtaacaactcactcctggccttcccgggc
acgcacacaggccacgtgcagcttgtggacctggccagcaccgagaagccgccagtggac
attcccgcccacgagggcgtcctgagctgcattgctctcaacctgcagggaacaagaatt
gcgaccgcatctgagaaagggacccttatacgaatatttgatacttcatcagggcattta
atccaggaactacgaagaggatctcaagcagctaatatttattgcattaacttcaatcag
gatgcttccctcatctgtgtgtccagtgaccacggcacggtgcacatttttgcagctgaa
gatccaaaaaggaataaacaatcaagtttggcatcagccagtttccttccaaaatacttc
agttccaagtggagtttctccaagtttcaggtcccctcaggctctccatgcatttgtgcc
tttgggacagagccaaacgctgtcattgcgatctgtgcggacggcagctactacaagttc
ctgttcaaccccaagggagagtgcgtccgggacgtgtatgcgcagttcctggagatgacc
gatgacaagctttga

DBGET integrated database retrieval system