KEGG   Bos taurus (cow): 506322
Entry
506322            CDS       T01008                                 

Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
bta  Bos taurus (cow)
Pathway
bta01521  EGFR tyrosine kinase inhibitor resistance
bta01522  Endocrine resistance
bta04010  MAPK signaling pathway
bta04012  ErbB signaling pathway
bta04014  Ras signaling pathway
bta04015  Rap1 signaling pathway
bta04062  Chemokine signaling pathway
bta04068  FoxO signaling pathway
bta04071  Sphingolipid signaling pathway
bta04072  Phospholipase D signaling pathway
bta04137  Mitophagy - animal
bta04140  Autophagy - animal
bta04150  mTOR signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04210  Apoptosis
bta04211  Longevity regulating pathway
bta04213  Longevity regulating pathway - multiple species
bta04218  Cellular senescence
bta04360  Axon guidance
bta04370  VEGF signaling pathway
bta04371  Apelin signaling pathway
bta04540  Gap junction
bta04550  Signaling pathways regulating pluripotency of stem cells
bta04625  C-type lectin receptor signaling pathway
bta04650  Natural killer cell mediated cytotoxicity
bta04660  T cell receptor signaling pathway
bta04662  B cell receptor signaling pathway
bta04664  Fc epsilon RI signaling pathway
bta04714  Thermogenesis
bta04720  Long-term potentiation
bta04722  Neurotrophin signaling pathway
bta04725  Cholinergic synapse
bta04726  Serotonergic synapse
bta04730  Long-term depression
bta04810  Regulation of actin cytoskeleton
bta04910  Insulin signaling pathway
bta04912  GnRH signaling pathway
bta04915  Estrogen signaling pathway
bta04916  Melanogenesis
bta04917  Prolactin signaling pathway
bta04919  Thyroid hormone signaling pathway
bta04921  Oxytocin signaling pathway
bta04926  Relaxin signaling pathway
bta04929  GnRH secretion
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta04935  Growth hormone synthesis, secretion and action
bta05010  Alzheimer disease
bta05022  Pathways of neurodegeneration - multiple diseases
bta05034  Alcoholism
bta05160  Hepatitis C
bta05161  Hepatitis B
bta05163  Human cytomegalovirus infection
bta05165  Human papillomavirus infection
bta05166  Human T-cell leukemia virus 1 infection
bta05167  Kaposi sarcoma-associated herpesvirus infection
bta05170  Human immunodeficiency virus 1 infection
bta05200  Pathways in cancer
bta05203  Viral carcinogenesis
bta05205  Proteoglycans in cancer
bta05206  MicroRNAs in cancer
bta05207  Chemical carcinogenesis - receptor activation
bta05208  Chemical carcinogenesis - reactive oxygen species
bta05210  Colorectal cancer
bta05211  Renal cell carcinoma
bta05213  Endometrial cancer
bta05214  Glioma
bta05215  Prostate cancer
bta05216  Thyroid cancer
bta05218  Melanoma
bta05219  Bladder cancer
bta05220  Chronic myeloid leukemia
bta05221  Acute myeloid leukemia
bta05223  Non-small cell lung cancer
bta05224  Breast cancer
bta05225  Hepatocellular carcinoma
bta05226  Gastric cancer
bta05230  Central carbon metabolism in cancer
bta05231  Choline metabolism in cancer
bta05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bta05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    506322 (NRAS)
   04012 ErbB signaling pathway
    506322 (NRAS)
   04014 Ras signaling pathway
    506322 (NRAS)
   04015 Rap1 signaling pathway
    506322 (NRAS)
   04370 VEGF signaling pathway
    506322 (NRAS)
   04371 Apelin signaling pathway
    506322 (NRAS)
   04068 FoxO signaling pathway
    506322 (NRAS)
   04072 Phospholipase D signaling pathway
    506322 (NRAS)
   04071 Sphingolipid signaling pathway
    506322 (NRAS)
   04151 PI3K-Akt signaling pathway
    506322 (NRAS)
   04150 mTOR signaling pathway
    506322 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    506322 (NRAS)
   04137 Mitophagy - animal
    506322 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    506322 (NRAS)
   04218 Cellular senescence
    506322 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    506322 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    506322 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    506322 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    506322 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    506322 (NRAS)
   04660 T cell receptor signaling pathway
    506322 (NRAS)
   04662 B cell receptor signaling pathway
    506322 (NRAS)
   04664 Fc epsilon RI signaling pathway
    506322 (NRAS)
   04062 Chemokine signaling pathway
    506322 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    506322 (NRAS)
   04929 GnRH secretion
    506322 (NRAS)
   04912 GnRH signaling pathway
    506322 (NRAS)
   04915 Estrogen signaling pathway
    506322 (NRAS)
   04917 Prolactin signaling pathway
    506322 (NRAS)
   04921 Oxytocin signaling pathway
    506322 (NRAS)
   04926 Relaxin signaling pathway
    506322 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    506322 (NRAS)
   04919 Thyroid hormone signaling pathway
    506322 (NRAS)
   04916 Melanogenesis
    506322 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    506322 (NRAS)
   04726 Serotonergic synapse
    506322 (NRAS)
   04720 Long-term potentiation
    506322 (NRAS)
   04730 Long-term depression
    506322 (NRAS)
   04722 Neurotrophin signaling pathway
    506322 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    506322 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    506322 (NRAS)
   04213 Longevity regulating pathway - multiple species
    506322 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    506322 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    506322 (NRAS)
   05206 MicroRNAs in cancer
    506322 (NRAS)
   05205 Proteoglycans in cancer
    506322 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    506322 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    506322 (NRAS)
   05203 Viral carcinogenesis
    506322 (NRAS)
   05230 Central carbon metabolism in cancer
    506322 (NRAS)
   05231 Choline metabolism in cancer
    506322 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    506322 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    506322 (NRAS)
   05225 Hepatocellular carcinoma
    506322 (NRAS)
   05226 Gastric cancer
    506322 (NRAS)
   05214 Glioma
    506322 (NRAS)
   05216 Thyroid cancer
    506322 (NRAS)
   05221 Acute myeloid leukemia
    506322 (NRAS)
   05220 Chronic myeloid leukemia
    506322 (NRAS)
   05218 Melanoma
    506322 (NRAS)
   05211 Renal cell carcinoma
    506322 (NRAS)
   05219 Bladder cancer
    506322 (NRAS)
   05215 Prostate cancer
    506322 (NRAS)
   05213 Endometrial cancer
    506322 (NRAS)
   05224 Breast cancer
    506322 (NRAS)
   05223 Non-small cell lung cancer
    506322 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    506322 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    506322 (NRAS)
   05161 Hepatitis B
    506322 (NRAS)
   05160 Hepatitis C
    506322 (NRAS)
   05163 Human cytomegalovirus infection
    506322 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    506322 (NRAS)
   05165 Human papillomavirus infection
    506322 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    506322 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    506322 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    506322 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    506322 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    506322 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    506322 (NRAS)
   01522 Endocrine resistance
    506322 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bta04131]
    506322 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    506322 (NRAS)
   04031 GTP-binding proteins [BR:bta04031]
    506322 (NRAS)
Membrane trafficking [BR:bta04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    506322 (NRAS)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   506322 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   506322 (NRAS)
  Exosomal proteins of breast cancer cells
   506322 (NRAS)
  Exosomal proteins of colorectal cancer cells
   506322 (NRAS)
GTP-binding proteins [BR:bta04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    506322 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ParA Ldh_1_N
Other DBs
NCBI-GeneID: 506322
NCBI-ProteinID: NP_001091458
BGD-bta: BT12943
Ensembl: ENSBTAG00000046797
VGNC: 32253
UniProt: A5D7R9
Position
3
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcctac
cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt
gtgtttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagata
aagcgtgtaaaggactcggatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccatgaactggccaaaagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaaaaagctcaacagcagtgatgatggcactcaaggc
tgtatggggttgccgtgtgtggtgatgtaa

DBGET integrated database retrieval system