KEGG   Bos taurus (cow): 506349
Entry
506349            CDS       T01008                                 

Gene name
INPP5E
Definition
(RefSeq) 72 kDa inositol polyphosphate 5-phosphatase
  KO
K20278  inositol polyphosphate 5-phosphatase INPP5E [EC:3.1.3.36]
Organism
bta  Bos taurus (cow)
Pathway
bta00562  Inositol phosphate metabolism
bta01100  Metabolic pathways
bta04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    506349 (INPP5E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    506349 (INPP5E)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.36  phosphoinositide 5-phosphatase
     506349 (INPP5E)
SSDB
Motif
Pfam: Exo_endo_phos
Other DBs
NCBI-GeneID: 506349
NCBI-ProteinID: NP_001179019
BGD-bta: BT19047
Ensembl: ENSBTAG00000001354
VGNC: 30213
UniProt: E1BAU6
Position
11
AA seq 656 aa
MPSKLVSLGHSETASQQPTAQGCLCPEGSMLKGLLPNSDEEPVPCLGSPAAGGRQGPERS
PELPLDTPEQVSNEDPRAQARPFTPKPPPPRPRLERALSLDEKGWRKRRFRTSREDLTVR
NGASPSGGSLQDEVPGTPARSGSPPCLSASLQEIPTARRAPGSGGPSSWGNCLSGMISTS
LDLLHREGASAGSTPRLASLLSPRPLPAMARNMASEGLRTANKVDPDHADYKLRLQARLF
RAHSSLGPGRPPSPLAYDDCSLHSSRSTFSLLAPIRAKDVRSRSYLEGSLLATGALMGAD
ELARYFPDRSVALFVATWNMQGQKELPPNLDELLLPAEADLAQDLYVVGVQEGCSDRREW
EARLQETLGPHYVMLYSAAHGALYMAVLIRRDLIWFCSEVESSTVTTRIVSQIKTKGALG
VSFTFFGTSLLFITSHFTSGDGKVGERLVDYSKTVQGLALPKNVPDTSPYRSDAADVTTR
FDEVFWFGDFNFRLSGGRAAVEAILKQDLSSSVQALLQHDQLTREMQRGSIFKGFQEPDI
HFLPSYKFDVGKDSYDTTSKQRTPSYTDRILYRSRHQGDICPVKYSSCPGVRTSDHRPVY
GLFRVKVRPGRDNIPLAAGKFDRDLYLLGIKRRISREIQRQQALKSQHASAICTVS
NT seq 1971 nt   +upstreamnt  +downstreamnt
atgccatccaagttggtgagcttggggcattcagagaccgcctcccagcagcccactgcc
caggggtgtctgtgtcctgaaggcagcatgctcaagggactgcttccgaacagtgatgaa
gagcctgtcccctgcctggggtccccggctgctggcggccgtcagggacccgagaggagc
ccagagctccccctggataccccagagcaagtcagcaacgaggacccacgggcccaagcg
agacccttcaccccaaagccgccgcccccgaggcccaggctggagcgggcgctgtccctg
gatgagaagggctggagaaagaggcgttttcgaaccagccgcgaggacctgactgtgcgg
aatggggccagcccctcggggggctccctgcaggacgaggtccccgggacccccgcccgc
agtggctccccgccctgcctgagcgcctccctgcaggagatccccacagctcgcagggcc
ccgggcagcggggggccctcctcatggggaaactgtctttctgggatgatcagcacgtcc
ctggacttgctgcaccgggaaggggcctcggccgggagcacccctcggctggccagcctg
ctttccccgcgcccgctgcccgccatggcccgcaacatggcctccgaaggcctgcggacg
gcgaacaaggtggacccagatcacgccgactacaagctccggctgcaggccaggctgttc
cgggcgcacagcagcctgggtcccggccggcccccaagccccctggcctacgatgactgc
tcccttcactcgtccaggtccaccttcagcctcctggcgcccatccgtgccaaggacgtc
cggagcaggagctacctggaggggagcctgctggcaactggggccctgatgggggcagat
gagctggcccgttacttcccggaccggagcgtggccctgttcgtggccacgtggaacatg
cagggccagaaggagctgcccccgaacctggacgagctcctgctgccggccgaggctgac
ctggcccaggacctgtatgttgtgggcgtccaggagggctgctccgacaggcgggagtgg
gaggcgcggctacaggagacgctgggcccgcattacgtcatgctgtactcggcagcccac
ggcgcgctctacatggctgtgctcatccgcagggacctcatctggttctgctcagaggtg
gagagctccacggtgaccacccgcatcgtgtcccagatcaagaccaagggggccctgggc
gtcagcttcaccttcttcggcacctccctgctcttcatcacgtcccacttcacctctgga
gacgggaaggtgggcgagcggctggtggactacagcaagactgtgcagggcctggccctg
cccaagaacgtgccggacacgagcccctaccgctccgacgctgcggatgtcaccacccgc
ttcgacgaggtcttctggttcggggacttcaacttccgcctgagcggggggcgggcggcc
gtggaggccatcctgaagcaggacctcagctccagcgtgcaggccctgctgcagcacgac
cagctcacccgcgagatgcagagagggtccatcttcaagggcttccaggagccggacatc
cacttcctgccgtcatacaagttcgacgtcgggaaggactcgtatgacaccacctccaag
cagaggaccccatcctacacggaccgcatcctatacaggagccgccaccagggtgacatc
tgccccgtcaagtactcctcctgccccggcgtcaggacgtccgaccaccgccccgtgtac
ggcctgttccgggtcaaagtgaggccagggagagacaacatcccacttgccgctggcaag
tttgaccgggacctgtacctgctgggaatcaagagacgcatctccagagagatccagagg
cagcaggcactcaagagccagcacgccagcgccatctgcaccgtctcctga

DBGET integrated database retrieval system