KEGG   Bos taurus (cow): 506384Help
Entry
506384            CDS       T01008                                 

Gene name
PARP16
Definition
(RefSeq) mono [ADP-ribose] polymerase PARP16
  KO
K00774  poly [ADP-ribose] polymerase 16 [EC:2.4.2.30]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    506384 (PARP16)
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     506384 (PARP16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP ARTD15_N
Motif
Other DBs
NCBI-GeneID: 506384
NCBI-ProteinID: NP_001076848
BGD-bta: BT29389
Ensembl: ENSBTAG00000012352
UniProt: A4FV46
Position
10
AA seq 322 aa AA seqDB search
MQPAGWAAVREAAGRDVLAADLRCSFFASALRSYKRDSVLRPFPASYARHDCKDFEALLA
DASKLPNLKELLQSSGEKDPWAWDLMSWILSSKVLTIHSAGKSEFEKIQKLTGTPHSPVP
VPDFLFEIEYSDPANAKFYETKGERDLIYAFHGSRLENFHSIIHNGLHCHLNKTSLFGEG
TYLTSDLSLALIYSPHGHGWQHSLLGPILSCVAVCEVIDHPDVKCQTKKKDSKEIDRRRA
RIKHSEGGDVPPKYFVVTNNQLLRVKYLLVYSQKQPNRASSQLSWVSSHWFMVMITLYLL
LLLTVSVINSSAFQHFWNRAKR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccgcggggtgggcggccgtcagggaggcggcaggccgtgacgtgctggccgcc
gacctgcgctgcagcttcttcgcctcggccctgcggagctacaagcgcgactcagtgctg
cggcccttccccgcgtcctatgcccgccacgactgcaaggacttcgaggccctgcttgca
gatgccagcaagttacctaacctgaaagaacttctccagtcctcaggagaaaaagaccca
tgggcctgggacctgatgagctggattttatcgtcaaaggtcctgacaatccacagtgca
gggaagtcagagtttgaaaagatccaaaagctgactggtacccctcactcgcctgtccct
gtgccggacttcctgtttgaaatcgagtactccgacccagccaatgccaaattttacgag
accaaaggagaacgcgacctcatctacgccttccatgggagccgcctagagaacttccat
tccatcatccacaatggcctgcactgccacctgaacaagacatccttgtttggggaaggg
acctacctcaccagtgacctgagcctggccctcatttacagcccccatggccacgggtgg
cagcacagtctcctcggccccatccttagctgcgtggctgtgtgtgaggtcattgaccat
ccagacgtcaagtgccaaacgaagaagaaggattccaaggagatagatcgcaggagagcg
agaatcaagcacagtgaagggggcgacgtccctccaaagtactttgtggtcactaataac
cagctcttgcgcgtgaagtacctgctggtgtactcgcagaagcagcccaacagggcttcc
agccagctctcctgggtctccagccattggtttatggtcatgatcaccctgtatctgctg
ctgctgctcacagtgagtgtcatcaactcctcagctttccaacacttttggaatcgtgcg
aagagataa

DBGET integrated database retrieval system