KEGG   Bos taurus (cow): 506537Help
Entry
506537            CDS       T01008                                 

Gene name
ALG14
Definition
(RefSeq) UDP-N-acetylglucosamine transferase subunit ALG14 homolog
  KO
K07441  beta-1,4-N-acetylglucosaminyltransferase [EC:2.4.1.141]
Organism
bta  Bos taurus (cow)
Pathway
bta00510  N-Glycan biosynthesis
bta01100  Metabolic pathways
Module
bta_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    506537 (ALG14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bta01003]
    506537 (ALG14)
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.141  N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase
     506537 (ALG14)
Glycosyltransferases [BR:bta01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   506537 (ALG14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alg14 DUF4336 DUF4131
Motif
Other DBs
NCBI-GeneID: 506537
NCBI-ProteinID: NP_001071331
BGD-bta: BT21813
Ensembl: ENSBTAG00000004422
VGNC: 25826
UniProt: Q17QD5
Position
3
AA seq 173 aa AA seqDB search
MGGALILAAAAGALALLLLAVRLWVVLSPRAPVPRRSLSLLVVAGSGGHTTEILRLLENL
SNAYSPRHYIVADTDEMSTHKINSFEQIRADRNPSATVLCNGPGTCVPICISALLLGILG
IKKVIIVYVESICRVEHLSLSGKILFHLSDYFIVQWPTLKEKYPKSVYLGRIV
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgggtggtgcccttatcctcgcggcggctgcaggagccctggccttgctgctgctggca
gtacggctgtgggtagtcctgagtcctcgcgctcctgtgcctcggcggtctctcagcctc
ttggtggtggctggatctggtgggcataccactgagatcctaaggctgctggagaacctg
tccaatgcttattctcctagacattatatcgttgctgacactgatgaaatgagtacccat
aaaataaattcttttgaacaaattcgagctgatagaaaccccagtgctacggtgttgtgt
aacggaccaggaacatgtgttcctatctgtatatctgcccttctccttggaatactggga
ataaagaaagtgatcattgtctacgttgagagcatctgccgagtggaacatttatccctg
tccggaaagattctgtttcacctctccgattacttcattgttcagtggccaactcttaag
gagaagtatcccaaatctgtgtacctcgggcgaattgtttga

DBGET integrated database retrieval system