KEGG   Bos taurus (cow): 506917
Entry
506917            CDS       T01008                                 

Gene name
HNRNPF
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein F
  KO
K12898  heterogeneous nuclear ribonucleoprotein F/H
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bta03041]
    506917 (HNRNPF)
Spliceosome [BR:bta03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    506917 (HNRNPF)
SSDB
Motif
Pfam: RRM_1 zf-RNPHF
Other DBs
NCBI-GeneID: 506917
NCBI-ProteinID: NP_001014860
BGD-bta: BT17616
Ensembl: ENSBTAG00000008853
UniProt: Q5E9J1
Position
28
AA seq 414 aa
MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGVAGVHFIYTREGRQSGEAFVE
LESEDDVKLALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSADTANDGFVRLRGLPF
GCTKEEIIQFFSGLEIVPNGITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRY
IEVFKSSQEEVRSYSDPPLKFMSVQRPGPYDRPGTARRYIGIVKQAGLERMRSGAYSAGY
GGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDGEFTVQSTTGHCVHMRGLPYKA
TENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAVAAMSKDRANMQHRYIELF
LNSTTGASNGAYSSQMMQGMGVSTQSTYSGLESQSVSGCYGAGYGGQNSMGGYD
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgatgttgggccctgagggaggtgaaggctttgtggtcaagctccgtggcctgccctgg
tcctgctctgttgaggatgtgcagaatttcctctccgactgcacgatccatgacggggtc
gcaggtgttcactttatctacactagagaaggcaggcagagtggtgaggcttttgtcgaa
cttgaatcagaagatgacgtaaaattggcccttaaaaaagacagggaaagcatgggacat
cggtacattgaagtgttcaagtcccacagaaccgagatggattgggtgttgaagcacagt
ggtccaaacagtgctgacactgccaatgatggtttcgtgcgacttcgaggactcccgttt
ggatgcaccaaggaagagatcattcagtttttctcagggttggaaatcgtgccaaacggg
atcacattgcctgtggaccccgagggcaagattacaggggaagcctttgtgcagtttgcc
tcacaggagttagcagagaaggctctagggaagcacaaggagagaatagggcacaggtat
attgaggtgttcaagagcagtcaggaagaagttaggtcatactcggatcccccactgaag
ttcatgtcagtgcagcggccagggccctatgaccgccctggcacagccaggaggtatatt
ggcatcgtcaagcaggcaggtctggagaggatgaggtctggtgcctacagtgcaggctat
ggggggtatgaggagtacagcggcctcagtgatggctacggcttcaccaccgacctgttt
gggagagacctcagttactgtctctctggaatgtacgaccacaggtatggagatggtgag
ttcactgtccagagcaccactggacactgtgtccacatgagaggtctgccctacaaagcc
acagagaacgacatttacaacttcttctccccgctcaaccctgtgagagtccacattgag
atcggccctgatggaagagtgaccggcgaagctgatgttgagtttgccactcatgaagaa
gccgtggcggccatgtccaaagacagggccaatatgcaacatcgatacatagaacttttc
ttaaattccacaacaggggccagcaacggggcatatagcagccagatgatgcaaggcatg
ggggtgtcaacccagtccacttacagtggccttgagagccagtctgtgagcggctgttac
ggggctggctatggtggccagaacagcatgggtggatatgactag

DBGET integrated database retrieval system