KEGG   Bos taurus (cow): 507080
Entry
507080            CDS       T01008                                 

Gene name
PIGL
Definition
(RefSeq) N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
  KO
K03434  N-acetylglucosaminylphosphatidylinositol deacetylase [EC:3.5.1.89]
Organism
bta  Bos taurus (cow)
Pathway
bta00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
bta01100  Metabolic pathways
Module
bta_M00065  GPI-anchor biosynthesis, core oligosaccharide
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    507080 (PIGL)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.89  N-acetylglucosaminylphosphatidylinositol deacetylase
     507080 (PIGL)
SSDB
Motif
Pfam: PIG-L
Other DBs
NCBI-GeneID: 507080
NCBI-ProteinID: NP_001093781
BGD-bta: BT24769
Ensembl: ENSBTAG00000013273
VGNC: 32871
UniProt: A6QQ24
Position
19
AA seq 253 aa
MEVAAPLLCLAAAVLVWGVLWVWGSWERMTRPEQAGLPGGGSRTLLVTAHPDDEAMFFAP
TILGLARLRHQLFLLCFSAGNYYNQGEIRKKELLQSCDVLGIPPSNVMIIENRDFPDDPD
VRWDPDRAADVLLQHVEANGIKLVVTFDEGGVSGHSNHVALNAAVRTLQAEGKLPKGCSV
LTLQSVNLLRKYLCLLDLPCSLLLARDALFVLTQREAAQAQRAMSCHRSQLLWFRRLYML
FSRYMRINSLNFL
NT seq 762 nt   +upstreamnt  +downstreamnt
atggaagtggcggcgccgcttctgtgtttggcggcggctgtcctggtatggggcgttctc
tgggtttggggctcctgggagcgaatgacgaggccggagcaggctggcctgcccggaggc
ggaagccggacacttctggtgacggcgcaccccgacgatgaagccatgttctttgctccc
actattctaggcttggcccgcctgcggcaccagttgttcctgctctgcttctccgcagga
aattactacaatcaaggggagatccgtaagaaggaactcttgcagagctgtgatgttctg
gggattcccccctccaacgtaatgattattgaaaacagggatttcccagatgacccagac
gtgcgctgggacccagaccgggcagctgatgtcctcctccagcacgtagaggccaatggc
atcaagctggtggtgaccttcgatgaggggggcgtgagtgggcacagcaaccacgtggct
ctgaatgcagctgtgaggaccctgcaggcagaagggaagctacccaaagggtgctcggtg
ctcacgctccagtctgtgaacctgctgcgcaaatacctctgtctgctggacctaccctgc
tccctgctgctcgcccgcgacgccctcttcgtgctcacccaacgtgaggcagcccaggcc
cagagagccatgtcctgccaccgcagccagctgctctggttccgccgcctctatatgctg
ttctcccgctacatgaggattaactctctgaactttctctga

DBGET integrated database retrieval system