KEGG   Bos taurus (cow): 507309Help
Entry
507309            CDS       T01008                                 

Gene name
VAMP8
Definition
(RefSeq) vesicle-associated membrane protein 8
  KO
K08512  vesicle-associated membrane protein 8
Organism
bta  Bos taurus (cow)
Pathway
bta04130  SNARE interactions in vesicular transport
bta04140  Autophagy - animal
bta04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    507309 (VAMP8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    507309 (VAMP8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    507309 (VAMP8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bta04131]
    507309 (VAMP8)
Membrane trafficking [BR:bta04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    507309 (VAMP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Synaptobrevin Ferlin_C Orf78 MCU TMCO5 Prominin Baculo_F E1-E2_ATPase EVI2A Noelin-1 Stevor DUF2207 ODV-E18 Sec20 Use1
Motif
Other DBs
NCBI-GeneID: 507309
NCBI-ProteinID: NP_001029462
BGD-bta: BT11324
Ensembl: ENSBTAG00000023997
VGNC: 36760
UniProt: Q3T0Y8
Position
11
AA seq 100 aa AA seqDB search
MEASGGGGDDRVRNLRDEVEGVKNIMTQNVERILARGENLDHLRNKTEDLEATSEHFKTT
SQKVARKFWWKNVKMIVLICVIVFIIILFIVLFATGAIPT
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atggaggccagtggtggaggaggagatgaccgtgtgcggaacctcagggatgaagtggaa
ggggtcaagaatatcatgactcagaatgtggagcggatcctggcccggggagagaacctg
gaccaccttcgcaacaagacagaggatctggaagccacatcagagcacttcaagacgacg
tcacagaaggtggctcggaagttctggtggaagaacgtgaagatgattgtcctcatctgt
gtgattgtttttatcatcatcctcttcatcgtgctttttgccactggcgccatcccaact
tag

DBGET integrated database retrieval system