KEGG   Bos taurus (cow): 507437
Entry
507437            CDS       T01008                                 

Gene name
PTGER1
Definition
(RefSeq) prostaglandin E2 receptor EP1 subtype
  KO
K04258  prostaglandin E receptor 1
Organism
bta  Bos taurus (cow)
Pathway
bta04020  Calcium signaling pathway
bta04080  Neuroactive ligand-receptor interaction
bta05163  Human cytomegalovirus infection
bta05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    507437 (PTGER1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    507437 (PTGER1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    507437 (PTGER1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    507437 (PTGER1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bta04030]
    507437 (PTGER1)
G protein-coupled receptors [BR:bta04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    507437 (PTGER1)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 507437
NCBI-ProteinID: NP_001179077
BGD-bta: BT22526
Ensembl: ENSBTAG00000017041
VGNC: 33501
UniProt: F1MUY4
Position
7
AA seq 407 aa
MSPCGPLNLSLAGEATTCTAPGAPNTSAGPPLGLAGASPALPIFSMTLGAVSNVLALGLL
AQAAGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYAAGRAPAGGACHFLGGCM
VFFGLCPLLLGCGMAVERCVGVTRPLLHAARVSVARARLALAALAAVALAVALLPLARVG
RYELQYPGTWCFIGLGPAGGWRQALLAGLFAGLGLASLLAALLCNTLSGLALLRARWRRR
RSRRHFPAGGGPDSRRHWGGRGPRSASASSASSVASASAAPGGSPSRGSSRKARAHDVEM
VGQLVGIMVVSCICWSPLLVVVVLAVAGWGSSSLQRPLFLAVRLASWNQILDPWVYILLR
QAVLRQLLRLLPSRAGAKGSHGGLGLNKSTWEASSLRSSRHSGLSSF
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgagcccttgcgggcccctcaacctgagcctggcgggcgaggcgaccacgtgcacggca
cccggggcccccaacacgtccgccggaccaccgttgggcctggcgggcgcatcgcccgcg
ctgcccatcttctccatgacgctgggcgccgtgtccaacgtgctggcgctggggcttctg
gcgcaggccgcgggccgtctgcggcgccgccgctcagcagccaccttcctgctgttcgtc
gccagcctgctggccaccgacctggcgggccacgtgatcccgggtgcgctggtgctgcgc
ctgtacgcggcggggcgcgcgcctgccggcggcgcctgccacttcctgggcggctgcatg
gtcttcttcggcctgtgcccgctgctgctgggctgcggcatggccgtggagcgctgcgtg
ggcgtcacgcggccgctgttgcacgcagcccgcgtttcggtggcccgtgcgcggctggct
ctggcagcgctggccgccgtggccttggccgtggcgctgctgccgctggcgcgcgtaggc
cgctatgagctgcagtaccccggcacgtggtgcttcatcggactgggcccggcgggaggc
tggcgccaggcgctgctcgccggcctcttcgccggccttggcttggcttcgttgctcgcc
gcgctcctgtgcaacacgctcagcggcctggccctgctgcgcgcccgttggcggcgccgc
cgctctcgacgacacttcccagccggaggaggccccgacagccgccgtcactggggaggg
cgtggaccccgctcggcctccgcttcgtccgcctcgtccgtcgcttcggcctccgccgcc
ccgggcggctctccgagccgtggctcctcacgcaaagcccgcgcccacgacgtggaaatg
gtcggccagctcgtaggcatcatggtggtgtcgtgtatctgctggagtcccttgctggtg
gtggtggtgctggctgtcgcaggctggggctccagctccctgcagcggccgctgtttttg
gccgtgcgcctcgcctcgtggaaccagattctggacccctgggtgtacatcttgctgcgc
caagcagtgcttcgccaactgcttcgcctgctgccttcaagggcaggcgccaagggcagc
catggagggctaggcctaaacaagagcacttgggaggccagctcgctgcgcagttctcgg
cacagtggcctcagttctttttag

DBGET integrated database retrieval system