KEGG   Bos taurus (cow): 507672Help
Entry
507672            CDS       T01008                                 

Gene name
FOLR2
Definition
(RefSeq) folate receptor beta precursor
  KO
K13649  folate receptor
Organism
bta  Bos taurus (cow)
Pathway
bta01523  Antifolate resistance
bta04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    507672 (FOLR2)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    507672 (FOLR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bta02000]
    507672 (FOLR2)
   04147 Exosome [BR:bta04147]
    507672 (FOLR2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bta00537]
    507672 (FOLR2)
Transporters [BR:bta02000]
 Other transporters
  Others
   507672 (FOLR2)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   507672 (FOLR2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bta00537]
 Receptors
  507672 (FOLR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Folate_rec
Motif
Other DBs
NCBI-GeneID: 507672
NCBI-ProteinID: NP_001068793
BGD-bta: BT15735
Ensembl: ENSBTAG00000027684
UniProt: Q0VCN9
Position
15
AA seq 253 aa AA seqDB search
MPWKLTPLLLFLGWMTSVCSARTRTDLLNVCMDAKHHKAEPGPEDKLHNQCTPWKKNACC
SARVSQELHKDTSSLYNFTWDHCGKMEPACQRHFIQDNCLYECSPNLGPWIQEVNQKWRK
ERFLNVPLCKEDCQSWWEDCRTSYTCKSNWHRGWDWTSGSNKCPTGTICRTFEAYFPTPA
ALCEGLWSHSYKLSNYSRGSGRCIQMWFDPALGNPNEEVARFYALALTAEAWPQGIRPLL
LCLALMLSLWLHD
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgccctggaaactgacaccacttctgctttttctgggttggatgacctctgtgtgcagt
gcccggacccggacagacctgctcaacgtctgcatggatgccaagcaccacaaggcagaa
cccggccctgaggacaagctgcacaaccaatgcaccccctggaagaagaacgcctgctgc
tctgccagagtcagccaggagctgcacaaggacacctcctccttgtataactttacctgg
gaccactgtggcaagatggaacccgcctgccagcgccacttcattcaggacaactgtttg
tacgagtgctcacccaatctggggccctggatccaggaggtgaaccagaagtggcgcaaa
gaacggttcctgaacgtgcccctgtgcaaagaggactgtcagagctggtgggaagactgc
cgcacctcctacacctgcaagagcaactggcacagaggctgggactggacctcaggatct
aataagtgtccaactgggaccatctgccgcacatttgaggcctacttccccacacctgca
gccctgtgtgagggtctctggagtcactcctacaagctcagcaattacagccggggcagt
ggccgctgcatccagatgtggttcgaccctgccctgggcaaccccaatgaggaggtggcg
agattctatgccttggccttgactgctgaggcctggccccagggtattagacctctcttg
ctctgcctggccctgatgctgtcactctggctccatgactga

DBGET integrated database retrieval system