KEGG   Bos taurus (cow): 507834
Entry
507834            CDS       T01008                                 

Gene name
ESRRA
Definition
(RefSeq) steroid hormone receptor ERR1
  KO
K08552  estrogen-related receptor alpha
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bta03000]
    507834 (ESRRA)
   03029 Mitochondrial biogenesis [BR:bta03029]
    507834 (ESRRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:bta03310]
    507834 (ESRRA)
Transcription factors [BR:bta03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen-like
    507834 (ESRRA)
Mitochondrial biogenesis [BR:bta03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    507834 (ESRRA)
Nuclear receptors [BR:bta03310]
 3. Estrogen like
  3B. Estrogen-related receptor
   507834 (ESRRA)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 507834
NCBI-ProteinID: NP_001178302
Ensembl: ENSBTAG00000008645
VGNC: 28608
UniProt: F1MBX3
Position
29
AA seq 422 aa
MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGDGAG
PGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNE
CEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGP
LAVAGGPRKTAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTIS
WAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAAG
LGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALLE
YEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEAM
MD
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgtccagccaggtggtgggcattgagcctctctacatcaaggcagagccagccagccct
gacagcccaaagggttcctcggagactgagactgagccccccgtggctctggctcctggc
ccagcccccacccgctgcctcccaggccacaaggaagaggaggatggggatggggctggg
cctggcgagcagggtggtgggaagctggtgctcagctccctgcccaaacgcctctgcctg
gtctgtggggatgtggcctccggctaccactatggtgtggcatcctgtgaggcctgcaaa
gccttcttcaagaggaccatccaggggagcatcgagtacagctgtccggcctccaacgag
tgtgagatcaccaagcggagacgcaaggcctgccaggcctgtcgcttcaccaagtgcctg
cgggtgggcatgctcaaggagggggtacgtctggaccgcgtccgtggtgggcgacagaag
tacaagcggcggccagaggtggacccactgcccttcccaggccccttccctgctggacct
ctggcagtagctggaggccctcggaagacagccccggtgaacgcactcgtgtcccacctg
ctggtggttgaacctgagaagctgtatgccatgcccgacccagcgggccctgatggacac
ctcccagctgtggccaccctctgtgacctctttgaccgagagatcgtggtcaccatcagc
tgggccaagagcatcccaggcttctcgtcgctgtcactgtctgaccagatgtcagtactg
cagagtgtgtggatggaggtcctggtgttgggtgtggcccagcgctccctgccactgcag
gatgagctggccttcgccgaggacctggtcctggatgaagagggggcacgagccgctggc
ctgggggaactgggggctgccctgctgcagctggtgcggcgactgcaggccctgcggctg
gagcgcgaggagtacgttctgctgaaggccctggccctcgccaattcagactctgtgcac
attgaagatgctgaagcagtggagcagctgcgagaagctctacacgaggccctgctggag
tacgaagctggccgggcaggccccggagggggcgctgagcggaggcgggcaggcaggctg
ctgctcacactaccgctccttcgccagacagcgggcaaagtgctggcccatttctatggg
gtgaagctggagggcaaggtgcccatgcacaagctgtttttggaaatgctcgaggccatg
atggactga

DBGET integrated database retrieval system