KEGG   Bos taurus (cow): 508039
Entry
508039            CDS       T01008                                 

Gene name
FAAP20
Definition
(RefSeq) Fanconi anemia core complex-associated protein 20
Organism
bta  Bos taurus (cow)
SSDB
Motif
Pfam: FANCA_interact UBZ_FAAP20
Other DBs
NCBI-GeneID: 508039
NCBI-ProteinID: NP_001160036
BGD-bta: BT27950
Ensembl: ENSBTAG00000014136
UniProt: A5PKK9
Position
16
AA seq 192 aa
MEATRRSRLSLSRRRPPLGVRPRSNTAGSLPDGGECAKLWTELLRTASADLNVDGELPPL
PAFPDQEPRRSPERPPPETFTVGTETFFWTPFPAPSPGRGGNSGGSDLVLSAVRGRTGSP
QQYAAPELRGTPSAEEQPSEEQPSQRQSSVDGAMTLQSCPMCQVDFAPGLAQLDIDGHLA
QCLADSTDDIEW
NT seq 579 nt   +upstreamnt  +downstreamnt
atggaggctacgcggaggtcgcggctgagtctgagccgccggaggccgcccttgggggtc
cggcctcggagcaataccgccgggtccctcccggacggcggcgagtgcgcgaagctgtgg
actgagttgctgcgcaccgcgagcgcagacctgaacgtggacggcgagctgccgccgctg
cccgctttccccgaccaggagcccaggcgcagtcctgagcgtccgcccccggaaacattc
accgtgggaaccgagaccttcttctggacgcccttcccggcgccctcgccggggcgaggc
gggaactcgggcggctccgaccttgtgctcagcgcggtccgggggcgcacggggtccccc
caacaatatgcagcgcccgagctccgcggaacccccagcgccgaggagcagccctcggag
gagcagccctcccagcgacagtcgtcagtggacggtgcgatgaccttgcagagctgtccc
atgtgccaagtcgacttcgcccccgggctggcgcagctggacatcgatggccacctggcc
cagtgcctggcagacagcacggatgacatagagtggtga

DBGET integrated database retrieval system