KEGG   Bos taurus (cow): 508330Help
Entry
508330            CDS       T01008                                 

Gene name
KMT2A
Definition
(RefSeq) histone-lysine N-methyltransferase 2A isoform X1
  KO
K09186  histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
bta00310  Lysine degradation
bta04934  Cushing's syndrome
bta05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    508330 (KMT2A)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    508330 (KMT2A)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    508330 (KMT2A)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     508330 (KMT2A)
Transcription factors [BR:bta03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    508330 (KMT2A)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     508330 (KMT2A)
   HMT complexes
    MLL-HCF complex
     508330 (KMT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYRC SET FYRN PHD zf-CXXC zf-HC5HC2H zf-HC5HC2H_2 PHD_2 Bromodomain PHD_4
Motif
Other DBs
NCBI-GeneID: 508330
NCBI-ProteinID: XP_024831540
BGD-bta: BT29267
Ensembl: ENSBTAG00000018093
VGNC: 30690
Position
15
AA seq 4001 aa AA seqDB search
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAV
AAAAAAAGSGGAGVPGGAAAASAASSSSASSSSSSSSSASSGPALLRVGPGFDAALQVSA
AIGTNLRRFRAVFGESGGGGGSGELTTQIPCSWRTKGLIHDKKTEPFRLLAWSWCLNDEQ
FLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPRSGSDRNSALLSDPSVFSPLNKSETKSG
DKIKKRDSKSIEKKRGRPPTFPGVKLKITHGKDVSELPKGNKEDSLKKMKRTPSATFQQA
TKIKKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKP
QKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRIIPSSKRTDATIAKQLLQRAKKGAQKKI
EKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTP
NSRFSATSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTP
EVHTPLPISQSPEDDSSDRRSRRYSVSERSFGSRTTKKLSTLQSAPQQQTSSSPPPPLLT
PPPPLQPASSISDHTPWLMPPTIPLASPFLPTSAAPMQGKRKSILREPTFRWTSLKHSRS
EPQYFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSTSGPAASARLFSPLHSGTR
FDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSNRTSAGTSSSGVSNRKRKRKVFSPIRSE
PRSPSHSMRTRSGRLSTSELSPLTPPSSVSSSLSISVGPLATSALNPTFTFPSHSLTQSG
ESAEKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKERDADKS
VEKDKSRERDREREKENKRESKKEKRKKGSEIQSSSALYPMGRVSKEKAVGEDVATSSSA
KKATGRKKSSSLDSGTDIASVTLGDTTAVKTKILIKKGRGNLEKSNLDLGPTTPSLEKEK
TLCLSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTD
QPKAQGQESDSSETSVRGPRIKHVCRRAAVALGRKRAVFPDDMPTLSALPWEEREKILSS
MGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDC
GVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKE
SKESSTVKNSVDSSQKSTPSAREDPAPKKSNSDPPPRKSVEDKSEEGNTATPGPEAKHVA
TPASRKSSKQVSQPAPAIPPQPPSTAPPRKEVPKTTPSEPKKKPPPPPESGPEQSKQKKV
APRPSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKVPADGVHRIRVDFKE
DCEAENVWEMGGLGILTSVPITPRVVCFLCASSGHVEFVYCQVCCEPFHKFCLEENERPL
EDQLENWCCRRCKFCHVCGRQHQAAKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWIC
TKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQ
CGKCDRWVHSKCENLSGTEDEMYEILSNLPESVAYTCVNCTERHPAEWRLALEKELQISL
KQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQEDQQ
PLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMER
VFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREENSHTEQPPLMKKII
PAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSA
NDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVG
CCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVFRRVFVDFEGI
SLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKR
CVYTCKIVECRPPVVEPDINSTVEHDENRTIAHSPPSFAEISPKESQNTAEIVSPPSPDR
PPHSQTSGSCFYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPTTHEIVTVGDPLLS
SGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGSTYSRNSVSSVSTTGATADLESSAKAVD
HVLGPLNSNANLGQNTPTSSNLQRTAVTVGTKTSHLDGSSSLETKHSSASDLTSKSSSLK
GEKTKMPSSKNSEGSAHNVGYPGIPKLAPQVHNATAGELNVNKMGTFADLSSVPFSSKEG
LPFPPLHLRGQRNERDQQTNGNQSANPNPDEDAEVKTLKLSGVSSRSSIINEHVGASSRD
RRQKGKKSCKETFKEKHSSKPFLEPGQVATGEEGNLKPEFVDEMLTPDFMGQRSCNNVSS
EKTGDKVHPIPGVPKAPSMQVEGSAKELQTPRKRTVKVTLTPLKMESEGQSKNTLKESSP
VSPLQIESVSPTEPVSASESPGDGPVAQPSPNNTSSQDSQSNNYQNLPVQDRNLMLPDGP
KPQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQ
VDGADDLSTSDEDDLYYYNFSRTVISSGGEERLTPHNLFREEEQCDLPKISQLDGIDDGT
ESDTSVTATTRKSSQIPKRNSKENGTENLKMDRPEDTGEKEHVIKSSVGHKNEPKVDNCH
AVSRVKAPGQDSLEAQLSSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNI
LPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMGLFEVFSQQLPTT
EPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNSSRLAVISDSGEKRVTITE
KASSEGDSSLLSPGVDPSPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNS
NTPGLQVPVSPTVPIQNQKYAPNSTDSPGPSQISNAAVQTTPPHLKPATEKLIVVNQNMQ
PLYVLQTLPNGVTQKIQLTSSVSSAPSVMETNTSVLGPMGSGLTLTTGLNPNLPASQSLF
PPATKGLLPMSHHQHLHSFPAATQSSFPPNISSPSGLLIGVQPSPDPQLLVSEASQRTDL
STTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLINFTPSQLPNHPN
LLDLGSLNTSSHRTVPNIIKRSKSGIMYFEQAPLLPQSVGGTTAPAAGTATISQDTSHLT
TGPVSGLASGSSVLNVVSMQTTTAPTSSASVPGHVALTNPRLLGTPDIGSISNLLIKASQ
QSLGIQDQPVALPPSSGMFPPLGTSQTPSTGAMTAAPSICVLPSTQTAGVTAASPSGEAE
EHYQLHHVNQLLASKTGVLSSQRDLDSAPGSQGSSFTQTVDAPNPMGLEQNKALPSAMQA
SSASPGGSPSSGQRSASPSVPGPTKPKPKIKRIQLPLDKGSGKKHKVSHLRTSSSEAHIP
DQEANTTPQTSVTGTPGAEAEPQDTASVEQSPQKECGQPAAQVAALPEIQTTQNPAHEPE
NSEPKTAEEEESNFSSPLMLWLQQEQKRKESIAEKKPKKGLVFEISSDDGFQICAESIED
AWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFH
KPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARR
ATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQT
DKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVI
FAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN
NT seq 12006 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacagctgtcggtggcgcttccccgcccgacccgggaccaccgggggtggcggc
ggcggggggcgccggggcctagggggcgccccgcggcaacgcgtcccggccttgctgctt
ccccccgggcctccggtcggcggcggcggccccggggcgcccccctcccccccggctgtg
gcggccgcggcggcggcggcgggaagcggcggggccggggttccagggggagcggccgcc
gcctcagcagcctcctcgtcgtccgcctcgtcttcgtcttcgtcatcgtcctcagcctcc
tccgggccggccctgctccgggtgggcccgggcttcgacgcggcgctgcaggtctcggcc
gccatcggcaccaacctgcgccggttccgggccgtgtttggggagagcggcgggggaggc
ggcagcggagagctaacaacacagatcccatgtagttggagaaccaaaggcctcatacat
gacaaaaagactgaaccgttcaggttacttgcatggagttggtgcttaaatgatgagcag
ttcttaggttttggctcagatgaagaagtcagagtacgaagtcccacaaggtctccttca
gttaaaactagtcctcgaaaacctcgcgggagacctagaagtggctctgaccgaaattca
gctctcctctcagacccatctgtgttctcccctctaaataaatcagagaccaaatctgga
gataagatcaagaagagagattctaaaagtatagaaaagaagagaggaagacctcccacc
ttccctggagtaaaactcaaaataacacacggaaaggacgtttccgagttaccaaaggga
aacaaagaagatagcctgaagaaaatgaagcgcacgccttccgctacatttcagcaagcc
acaaagattaaaaaattaagagcaggtaaactctctcctctcaagtccaagtttaagaca
gggaagcttcaaataggaaggaagggggtacagattgtacgccggcgaggacggcctcca
tcaacagaaaggataaagaccccttcaggtctcctcattaactctgaactggaaaagccc
cagaaggtccggaaagacaaggaaggaacacctccactcacaaaagaagataagacagta
gtcagacaaagccctcgaaggattaagccggttaggattattccttcttctaaaaggaca
gatgcaacaattgctaagcagctcttgcagagggcgaaaaagggggctcaaaagaagatc
gagaaagaagcagctcagctgcaaggaagaaaggtgaagacacaggtcaaaaacatccga
cagttcattatgcctgttgtcagtgccatctcctcgcggatcatcaaaacccctcggcgg
ttcatagaggatgaagattatgaccctccaattaaaattgcccgactggagtctacaccg
aacagtagattcagtgccacatcctgtggatcttctgaaaaatcaagtgcagcatctcag
cactcctctcaaatgtcttcagactcctcccgatccagtagccccagtgtcgatacctcc
acggattctcaggcctctgaggagattcaggtccttcctgaagagcggagcgataccccc
gaagtccatacgccactgcctatttcccagtccccagaagatgacagcagtgaccggaga
agcagaaggtattcggtgtcggagagaagtttcggatccagaaccacgaaaaaattatcc
actctgcaaagtgccccccagcagcagacctcttcctcgccccctccacccctgctgaca
ccaccgcccccactgcagccagcctccagtatctctgaccacacaccttggctcatgcct
ccaaccatccccttagcatcaccatttttgcctacttccgccgctcccatgcaagggaag
cgaaaatctattttgcgggaaccgacgtttaggtggacttctctaaagcactctaggtca
gagccacagtacttttcctcagcaaagtatgccaaagaaggtcttattcgcaaaccaatc
tttgataatttccgcccccctccgctcactcctgaggatgtcggcttcgcgtccgggttt
tctacgtctggtcctgctgcttcagcccgattgttttcacctctccattctggaacaagg
ttcgatatgcacaaaaggagcccgcttctgagagcgccgaggtttactccgagtgaggct
cactctaggatatttgagtctgtaaccttgcctagtaatcgaacttctgctggcacatct
tcttcaggagtatctaacaggaaaaggaaaagaaaggtgtttagccctattcgatccgaa
ccaagatctccttctcactctatgaggacaagaagtggaaggcttagcacttctgagctg
tcacctctcaccccaccgtcttctgtctcctcctcattaagcatttctgttggtcctctt
gccactagtgccttaaacccaacttttacttttccttctcattccctgactcagtctggg
gaatctgcagagaaaaaccagagaccaaggaagcagaccagtgctccagcagagccattt
tcatccagtagtcccactcctctcttcccttggttcaccccaggctcccagactgaacga
gggagaaataaagacaaggcccccgaggagctgtccaaagagcgagatgctgacaagagt
gtggagaaggacaagagtagagagagagaccgggagagagaaaaggagaataagcgggag
tccaagaaagagaaaaggaaaaagggatcagaaattcagagtagctcggctttgtatcct
atgggtagagtttccaaagagaaggctgttggtgaagatgtggccacttcatcttctgcc
aaaaaagcaaccgggcggaagaagtcttcatcactcgattctgggactgatattgcttct
gtgactcttggggatacgacagctgtcaaaaccaaaatacttataaagaaagggagagga
aatctggaaaaaagcaacttggacctcggcccaactaccccatccctggagaaggagaaa
accctctgcctttccactccttcatctagcactgttaaacattccacttcctccataggc
tccatgttggctcaggcagacaagcttccaatgactgacaagagggttgccagcctccta
aaaaaggccaaagcccagctctgcaagattgagaagagtaagagtcttaaacaaactgac
cagcccaaagcacagggtcaagaaagtgactcctcggagacctctgtgcgaggaccccgg
attaaacatgtctgcagaagagctgctgttgcccttggccgaaaacgagctgtgtttcct
gatgacatgcccaccctgagtgccttaccatgggaagaacgagaaaagattttgtcttcc
atgggaaatgatgacaagtcatcgatcgctggctcagaagatgctgaacctcttgctcca
cccatcaaaccaattaagcctgtcaccagaaacaaggcgcctcaggaacctccggtgaag
aagggacggcgatccaggcggtgcgggcagtgtcccggctgccaggtgcctgaggactgt
ggtgtttgcactaactgcttggataagcccaaatttggtggccgcaacataaagaagcag
tgctgcaagatgcgaaaatgtcagaatctacaatggatgccttccaaagcctaccttcag
aagcaagcaaaagctgtgaaaaagaaagagaagaaatctaagaccagtgaaaagaaggag
agcaaagagagcagcactgtgaagaactcggtggactccagtcagaaatctaccccatcg
gcaagagaggatcctgcccctaagaaaagcaacagtgaccctcctccccgcaaatccgtg
gaggacaagagtgaggaagggaacaccgccaccccaggacctgaggccaagcacgtggcc
acgcccgcttccaggaagtccagcaagcaggtctcccagccggcaccagccatcccccca
caaccccccagcacagcaccaccgagaaaagaagttcccaagaccactcccagtgagccc
aagaaaaagccacctccacctccagagtcaggtccagagcaaagcaagcagaaaaaagtg
gctcctcgcccaagtattcctgtaaaacaaaagccaaaagaaaaggagaaaccacctccg
gtcaataagcaggaaaatgcaggcactttgaacatcctcagcactctctccaatggcaat
agctccaagcagaaagttccagcagatggagtccacaggatcagagtggactttaaggag
gattgtgaagcagaaaatgtgtgggagatgggaggcttaggaatcttgacctctgtccct
ataacacccagggtagtttgctttctctgtgccagtagtggccacgtagagtttgtgtat
tgccaagtctgttgtgagcccttccacaagttttgtctggaggagaacgagcgccctctg
gaggaccagctggaaaactggtgttgtcgccgctgcaagttctgtcatgtctgtgggagg
cagcatcaggctgcaaagcagctgctggagtgtaacaagtgccgaaacagctatcaccct
gagtgcctgggaccaaattaccccaccaaacccacaaagaaaaagaaggtttggatctgt
acgaagtgtgttcgctgcaagagctgtggatctacgactcccggcaaagggtgggatgca
cagtggtctcacgatttctcactgtgccatgattgtgccaaactctttgctaaaggaaac
ttctgccctctctgtgataagtgttatgatgatgatgactatgagagtaagatgatgcag
tgtgggaaatgtgatcgatgggtccattccaaatgtgagaatctttcaggtacagaagat
gagatgtatgagattctgtctaatctgccagagagtgtggcctacacgtgtgtgaactgc
acagagcggcaccctgcggagtggcgactggcccttgagaaagagctccagatctcgctg
aagcaagtactgacagccttgttgaactctcggaccaccagccacctgctgcgctaccga
caggctgccaaacctccggacttaaatcctgagacagaggagagtataccttctcgtagc
tccccagaaggacctgatccaccagtgctcactgaggtcagcaaacaggaagatcaacag
cctttagatctggaaggagtcaagaggaaaatggaccaagggaactacacatctgtgttg
gagttcagcgacgatatcgtgaagatcattcaagcagccattaattcagatggagggcag
ccagagattaaaaaagccaacagcatggtcaagtccttctttattcggcaaatggaacgt
gtttttccatggttcagtgtcaaaaagtccaggttttgggagccaaataaagtatcaagc
aacagtgggatgttaccaaacgcagtgcttccaccttcacttgaccataattatgctcag
tggcaggagcgagaggaaaacagccacactgagcagcctcctttaatgaagaaaatcatt
ccagctcccaaacctaaagggcctggagaaccagactcaccaactcctctgcatcctcct
acaccaccaattttgagtactgataggagtcgagaagatagtccggaactgaacccaccc
ccaggcatagaagataacagacagtgtgcattgtgtttgacgtatggtgacgacagtgct
aatgatgctggccgtttgctttacattggccagaatgaatggacacatgtaaattgcgct
ctgtggtcagcagaagtgtttgaagacgatgatggatcactaaagaatgtgcatatggct
gtgatcaggggcaagcagctgagatgtgaattctgccaaaagccaggagccactgtgggt
tgctgccttacatcctgcaccagcaactatcacttcatgtgttcccgagccaagaactgt
gtgtttctggatgataaaaaagtgtattgccaacgacatcgggatttgatcaaaggcgag
gtggttcctgagaatggatttgaagtttttagaagagtgtttgtggactttgaaggaatc
agcttgagaaggaagtttctcaatggattagaaccagaaaatatccacatgatgattggc
tccatgacaattgactgcttagggattctgaatgatctctctgactgtgaggataagctc
tttcctattggatatcagtgttctcgggtgtactggagcaccacggacgcccgcaagcgc
tgcgtgtacacgtgcaagatcgtcgagtgccgtcccccggtggtggagccagatatcaac
agcactgttgaacatgatgaaaacaggaccatcgctcacagtccaccgtcttttgcagaa
atttcacccaaggaaagtcaaaacacagcagaaattgtaagtcctccatcaccagatcga
cctcctcattcccaaacctctggttcctgtttctatcacgtcatctcaaaggtccctagg
attcgaacacccagctattctccaacacagagatctcctggctgtagaccactgccttct
gcaggaagccctaccccaaccactcatgaaatagtcacagtgggtgaccctttactctcc
tctggacttcgaagcattggctccaggcgtcacagtacttcttccttgtcaccccagcgg
tctaagctccggataatgtctccgatgagaactgggagcacttactccaggaacagtgtc
tcctctgtctccaccacaggggccactgcggatctggagtcaagtgccaaagcggtcgat
catgtcttagggccactgaattctaatgctaatttagggcagaacactcccacctcttca
aatttgcaaaggacagcggttactgtgggcactaaaaccagtcacttggatggctcttca
tctttagaaacgaagcattccagtgcttcagacttgacatccaagagctcctctttgaag
ggagagaagaccaaaatgccgagttccaagaactcagagggatcggcccataatgttggt
taccctggcattccgaaactggctccgcaggttcataatgcaacagctggagaattaaat
gttaataaaatgggcacttttgctgacctttcttcagtgccattttcttctaaagagggc
ctccccttcccaccactccatttgagagggcagagaaacgagcgagaccaacagacaaat
ggcaaccagtcagcaaaccccaatcccgatgaagatgctgaagtcaaaaccttgaagctg
tctggagtgagcagcagatcatccattatcaatgaacacgtgggagccagctccagagat
aggagacagaaagggaaaaaatcttgtaaagaaactttcaaagaaaagcattccagtaaa
cctttcttggaacctggtcaggtggcaactggtgaggaaggaaacctaaagccagagttt
gttgatgaaatgttgactcctgatttcatggggcaacgatcatgtaataatgtttcttct
gagaagactggggacaaagtccatcctattccaggagtccccaaagctccatccatgcaa
gtggaaggatctgcaaaggaattacagacaccccggaaacgcacagttaaagtaacactg
acacctctaaaaatggagagtgagggtcagtccaagaacaccctgaaagaaagtagtccc
gtttcccctttgcagatagagtctgtgtctccaacagaaccagtttctgcctcagaaagc
ccaggagatggtcctgtggcccaaccaagccccaataatacgtcatcccaggattctcaa
agtaacaactatcagaatcttccagtacaggacagaaacctgatgcttccggatggcccc
aaacctcaggaagatggctctttcaagaggagatacccccgccgcagtgcccgggcacgc
tctaacatgttctttgggctcaccccactctatggagtaaggtcctatggcgaagaagac
attccattttacagcagctcaactgggaagaagcgaggcaagaggtccgctgaaggacag
gtggacggggcagacgacctgagcacttcagatgaagacgacttatactattacaacttc
tctaggacagtgatttcttcaggtggagaggaacggctgacaccccataatttatttcgg
gaggaagaacagtgtgatcttccaaaaatctcacagttggatggcatcgacgatgggaca
gagagtgataccagcgtcacagccacaactcggaagagcagccagattccaaaaagaaac
agtaaagaaaacggaacagagaacttgaagatggatcggcctgaagacactggggaaaag
gaacatgtcattaagagctcagttggccacaagaatgagccaaaggtggataactgccac
gccgtgagcagagtgaaagcaccggggcaggactccctggaggctcagctcagctcgctg
gagtcgagccgcagggtccacacaagcaccccttcagataaaaacttgctggacacctat
aacaccgagctcctgaagtcagattcggataacaacaacagtgacgactgtgggaacatc
ctgccctcggacattatggactttgtcctaaagaatactccgtccatgcaggctttgggt
gagagcccagagtcctcttcgtcagaactcctcaaccttggtgaaggcttgggtcttgac
agcaatcgtgaaaaagacatgggtctttttgaagtgttttcccagcagttgccgacgaca
gagcctgtggacagtagtgtctcttcctccatctcagcggaggagcagtttgagttgccc
ttagagctgccatcagatctctccgtcctgaccacccggagtcccacggtccctagccag
aactccagtaggctagccgtgatctcagactcaggagagaagagagtaaccatcacagaa
aaagcttcctctgaaggcgactcctccctgctgagtccaggagtagatcccagtcctgag
ggccacatgactcccgaccactttatccagggtcacatggatgcggaccacatctccagc
cctccctgtggctctgtggagcaaggtcatggcaacaatcaggacttaactagaaacagc
aacacccctggccttcaggtacccgtttcccctactgttcccatccagaatcagaaatac
gcgcccaactccactgacagtcctggcccgtctcagatttccaatgccgctgtccagacc
actccgccccacctgaagccagccactgagaaactcattgttgttaaccagaacatgcag
ccactctacgtcctccaaacccttccgaatggagtgacccagaaaatccagctgacctcg
tctgtaagttcagcacccagtgtgatggagacaaacacgtccgtgttgggccccatggga
agtggtctcaccctcaccacaggactcaacccgaacctgccagcctctcagtcgttgttc
cctcctgctaccaaaggcttgctccccatgtctcatcaccagcacttacattccttcccc
gccgctactcagagtagcttcccccccaacatcagcagtccttcgggcctactcatcggg
gttcagccttctccagacccccagcttttggtttcagaagccagccagaggacagacctc
agtaccacggtagccactccatcctctggactcaagaaaagacccatatctcgcctgcag
acccgaaagaataagaaacttgccccctctagtaccccttccaacattgccccttcagac
gtggtttccaacatgacactgattaacttcactccctcccaacttccgaatcatcccaat
ctcttagacttggggtcactgaatacttcatctcaccgaactgtccccaacatcataaaa
aggtctaaatctggcattatgtattttgaacaggcacccctgctaccgcagagtgtgggg
gggaccactgccccggcggcaggcactgctaccataagccaggataccagccacctcacg
acagggcccgtgtctggcctggcctccggttcctccgtcctgaacgttgtatccatgcaa
actaccaccgcccccacaagtagtgcatctgttccaggacacgtcgcgttaaccaacccc
aggttgctgggtaccccggatatcggctccataagcaatcttctaatcaaagccagccag
cagagcctggggattcaagaccagcctgtggctttaccgccaagttcgggaatgtttcca
ccactggggacgtcacagactccctccacgggcgcgatgacggctgcacccagcatctgt
gtgctcccctctacccagacagcgggtgtcacagctgcttcgccttctggggaagcagaa
gaacactatcagctccaccatgtgaaccagctcctcgccagcaaaactggggttctctct
tcccaacgggatcttgattctgctccaggatcccagggatccagctttacccagacagta
gatgctcctaatcccatgggcctggagcagaacaaggctttaccctcagctatgcaagcc
agctcagcctctccagggggttccccatcctccggacagcggtcagcgagtccctcagtg
ccggggcccacgaaacccaaaccaaaaatcaaacggattcagctgcctttggacaaaggg
agtggcaagaagcacaaagtttcccacttgcggaccagttcttctgaagcacacattcca
gaccaagaagccaacacgacaccccagacctcagtcacagggactccaggagcagaggct
gagccgcaggatacagctagtgtggagcagtcaccacagaaggagtgtgggcagcctgca
gcgcaagtggctgctcttcctgagattcagacaacacagaatccagcacatgaaccagaa
aattcagaacctaaaacggcggaagaggaagaaagtaatttcagctctccactgatgctt
tggctccagcaagaacagaagcggaaagaaagcattgctgagaaaaagcccaagaaagga
cttgtttttgaaatttcaagtgatgatggctttcagatatgtgcagaaagtattgaagat
gcctggaagtcgctgacagacaaagtccaggaggctcggtccaacgcccgcctgaagcag
ctctcatttgcaggtgtgaacggtttgcggatgctggggattctccatgacgctgttgta
ttcctgattgagcaactgtctggtgccaagcactgtaggaattacaaattccgtttccac
aaaccagaggaggccaatgagcccccactgaaccctcacggctcagccagggctgaagtc
cacctgaggaagtcagcctttgacatgtttaacttcctggcttctaaacaccggcagcct
cctgagtacaaccccaatgacgaggaagaggaggaggtgcagctgaagtcagctcggagg
gcaactagtatggatctaccaatgcccatgcgtttccggcacttaaaaaagacttctaag
gaggcagttggtgtctacaggtctcccatccacggccggggtcttttttgtaagagaaac
attgatgcaggtgagatggtgattgagtatgctggcaacgtcatccgttccatccagact
gacaagcgagagaagtactatgacagcaagggcatcggctgctacatgttccggatcgat
gactctgaggtggtggacgccaccatgcacgggaacgccgcccgcttcatcaaccactca
tgtgagcccaactgctactctcgggtcatcaacatcgacgggcagaagcacattgtcatc
ttcgccatgcgcaagatctaccgaggggaggaactcacttacgactataaattccccatt
gaggacgccagcaacaagctcccctgcaactgtggtgccaagaaatgccggaagttccta
aactaa

DBGET integrated database retrieval system