KEGG   Bos taurus (cow): 508582
Entry
508582            CDS       T01008                                 

Gene name
ACAP1
Definition
(RefSeq) arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1
  KO
K12489  Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein
Organism
bta  Bos taurus (cow)
Pathway
bta04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    508582 (ACAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bta04131]
    508582 (ACAP1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    508582 (ACAP1)
   04990 Domain-containing proteins not elsewhere classified [BR:bta04990]
    508582 (ACAP1)
Membrane trafficking [BR:bta04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    508582 (ACAP1)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    508582 (ACAP1)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   508582 (ACAP1)
Domain-containing proteins not elsewhere classified [BR:bta04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   508582 (ACAP1)
SSDB
Motif
Pfam: BAR_3 ArfGap PH Ank_2 Ank_4 Ank_5 PH_11
Other DBs
NCBI-GeneID: 508582
NCBI-ProteinID: NP_001096704
Ensembl: ENSBTAG00000010527
VGNC: 25526
UniProt: A5PK26
Position
19
AA seq 745 aa
MTVKLDFEECLKDSPRFRASVELVEAEVSELETRLEKLLKLGNGLLESGRHYLAASRAFI
VGICDLAHLGPPEPMMAECLDKFTQSLSHKLDSHAELLDATQHTLQRQIQTLVKEGLRSF
REAGRDFWRGAESLEAALTHNAEVPRRRAQEAEEAGAALKVARAGYRGRALDYALQINVI
EDKRKFDIMEFVLRLVEAQATHFQQGHEELSQLAQYRKELGGQLHQLVLNSAREKRDMEQ
RHVLLKQKELGGEEPEPSLKEGPGGLVMEGHLFKRASNAFKTWSRRWFTIQSNQLVYQKR
YKDPVTVVVDDLRLCTVKLCPDSERRFCFEVVSPSKSCLLQSDSERLMQLWVSAVQSSIA
TAFSQARLDDSPRGLGQGSGHLAISSAATLGPGGLTRGREPGGVGHVAAQVQSVDGNAQC
CDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLDSWEPELVKLMCELGNVV
INQIYEARVEAMAVKKPGPSCSRQEKEAWIHAKYVEKKFLTKLPEIRGRRGGRGPPRGHP
PVPPKPGLIRPKPGSFRSKPEPPSEDLQSLHPGALLFRAAGHPPSLPTMADALAHGADVN
WVNGGQENATPLIQATAAVRVLNSLLACEFLLQNGANVNQVDNQGRGPLHHATILGHTGL
ACLFLKRGADLGVRDSEGRDPLTIAVETANADIVTLLRLAKMREADAAQGQAGDETYLDI
FRDFSLMASDDPEKLSRRSHDLHTL
NT seq 2238 nt   +upstreamnt  +downstreamnt
atgacggtcaagctggattttgaggagtgtcttaaggactcaccccgcttccgagcctct
gtcgagctggtggaagccgaagtgtcagaattggagacccggctggaaaagctcctcaaa
ctggggaatggcctcctggaaagtgggcggcactaccttgccgccagccgggccttcatc
gtgggcatttgtgatcttgcccacctgggaccaccagagcccatgatggcggagtgtctg
gacaaattcactcagagcctgagccataagctggacagccatgctgagcttctcgacgcc
acccagcacacactgcagcggcaaattcagaccttggtcaaggaaggtctccggagcttc
cgagaggctggccgggatttctggcggggggccgagagcctggaggctgctcttacccac
aatgcagaggttcccaggcgccgggcccaggaggcagaagaggctggagctgctttgaag
gttgctcgagctgggtaccggggccgggccctggactatgccctgcagatcaatgtgatt
gaggacaagaggaagtttgacatcatggagtttgtgctgcgtttggtggaggcccaggct
acccatttccagcagggccacgaggagctgagccagctggcccagtatcgcaaggagctg
ggtggccagttacaccagctggtcctgaattcagcccgcgagaagagggacatggagcag
agacatgtgctgctaaaacagaaggagctgggtggggaggagccagagccaagcctaaag
gaggggcctggtggcttggtcatggaaggacatctcttcaaaagggccagcaatgcattt
aagacctggagcagacgctggttcactattcagagcaaccaactggtctatcagaagagg
tacaaggaccctgtgaccgtggtggtggatgaccttcgtctctgcacagtgaagctctgt
cctgactcagaaagacggttctgctttgaggttgtgtcccccagcaagtcttgcctcctg
cagtctgactcagagcgcctcatgcagctgtgggtcagcgccgtgcagagcagcatcgcc
acagccttcagccaggctcgccttgatgacagcccccggggtctaggccagggctcagga
cacctggccataagctccgctgccaccctgggccctggtgggttgaccaggggaagggag
cctgggggagtggggcacgtggcagcccaggtgcagagcgtggacggcaatgcccagtgc
tgtgactgccgggagcctgcccccgagtgggccagcatcaacctcggcgtcaccctctgc
attcagtgctctggcattcacaggagccttggagttcatttctccaaagtccggtctctg
acccttgactcatgggagccggaactcgtgaagctcatgtgtgagctgggaaatgtcgtc
ataaaccagatctatgaagcccgagtggaggccatggctgtgaagaagccaggacccagc
tgctcccggcaagagaaggaggcctggattcatgctaaatacgtggagaagaagttcctg
accaagcttcctgagattcgagggcgaagaggtggccgggggccccccaggggacatcct
cctgtgcccccaaagccagggcttatcaggcccaagccggggagcttcagatccaagcca
gagcccccctctgaggacctgcagagcctgcaccctggggccctgctctttcgagctgct
gggcaccctccatcccttcccaccatggctgatgcccttgcccatggagccgatgtcaac
tgggtcaacgggggtcaggagaatgccacaccgctgatccaggccacagctgctgtgaga
gtcttgaattctcttctggcctgtgagtttctcctccagaacggggcaaacgtgaaccag
gtggacaaccaaggccggggcccgctccaccacgcgacaattcttggccacacggggctg
gcctgcctgtttctgaaacggggagccgatctaggagttcgagactctgaaggcagagac
cccctgaccatcgccgtggaaacagccaacgctgacatcgtcactctgctacgattggca
aaaatgcgggaggccgacgcagcccagggccaggctggagacgagacatatcttgacatc
ttccgtgatttctccctcatggcatccgacgacccggagaagctgagccggcgtagtcat
gacctccacacgctttga

DBGET integrated database retrieval system