KEGG   Bos taurus (cow): 508631Help
Entry
508631            CDS       T01008                                 

Gene name
VMP1
Definition
(RefSeq) vacuole membrane protein 1
  KO
K21248  vacuole membrane protein 1
Organism
bta  Bos taurus (cow)
Pathway
bta04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:bta00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    508631 (VMP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNARE_assoc MerE
Motif
Other DBs
NCBI-GeneID: 508631
NCBI-ProteinID: NP_001068836
Ensembl: ENSBTAG00000011623
VGNC: 36806
UniProt: Q0VCK9
Position
19
AA seq 406 aa AA seqDB search
MAENGQNCDQRRVAMNKEQYNGNFTDPSSVNEKKRRDREERQNIVLWRQPLITLQYFSLE
TLVILKEWTSKLWHRQSIVVSFLLLLAVLTATYYVEGAHQQYVQRIEKQFLLYAYWIGLG
ILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGTISL
WSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAETAQDF
ASRAKLAVQNLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIK
MHIQKLFVIVAFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHRSEMGTPQG
ENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQRLDPKEKTK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaatggacaaaattgtgaccagagacgtgtagcaatgaacaaggaacaatat
aatggaaacttcacagacccctcttcagtgaatgaaaagaagaggagggatcgagaagaa
agacagaatattgtcctgtggagacagccactcattaccttgcagtatttttctctggaa
accctagtaatcttgaaggaatggacctcaaaattatggcatcgtcaaagcattgtggtg
tcttttttactgctgcttgctgtgcttacagctacgtattatgttgaaggagcacatcaa
cagtatgtgcaacgtatagagaaacagtttcttttgtatgcctactggataggcttagga
attttgtcttctgttgggcttggaacagggctgcacacctttctgctttatctgggtcca
catatagcttcagttacattagctgcttatgagtgcaattcagttaatttccctgaacca
ccttatcctgatcagattatttgcccagatgaagagggcactgaaggaaccatttcttta
tggagcatcatctcaaaagttaggattgaggcctgcatgtggggtatcggtacagcaatt
ggagagctacctccatatttcatggccagggcagctcgcctctcaggtgctgaaccagat
gatgaagagtatcaggaatttgaagaaatgctggaacatgcagagactgcacaagatttc
gcctcccgggctaaactggcagttcaaaatctagtacagaaggttggattttttggaatt
ttagcctgtgcttcaattccaaatcctttgtttgatctggctggaataacatgtggacac
tttcttgtacctttttggactttctttggtgcaaccctgattggaaaagcaataattaaa
atgcatatccagaaactcttcgtgatcgtagcattcagcaaacatatagtggagcagatg
gtggctttcattggtgctgtccccggcataggtccgtctctgcagaagccattccaggaa
tacctggaggcccagcggcagaagcttcaccacagaagcgaaatgggcacaccgcaggga
gaaaactggttgtcctggatgtttgagaagttggttgttgtaatggtgtgttacttcatc
ctgtccatcattaactccatggcacaaagttacgccaaacgaatccagcagcgattggac
ccaaaggagaaaaccaaataa

DBGET integrated database retrieval system