KEGG   Bos taurus (cow): 508683Help
Entry
508683            CDS       T01008                                 

Gene name
PFKL
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, liver type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bta  Bos taurus (cow)
Pathway
bta00010  Glycolysis / Gluconeogenesis
bta00030  Pentose phosphate pathway
bta00051  Fructose and mannose metabolism
bta00052  Galactose metabolism
bta01100  Metabolic pathways
bta01200  Carbon metabolism
bta01230  Biosynthesis of amino acids
bta03018  RNA degradation
bta04152  AMPK signaling pathway
bta05230  Central carbon metabolism in cancer
Module
bta_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    508683 (PFKL)
   00030 Pentose phosphate pathway
    508683 (PFKL)
   00051 Fructose and mannose metabolism
    508683 (PFKL)
   00052 Galactose metabolism
    508683 (PFKL)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    508683 (PFKL)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    508683 (PFKL)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    508683 (PFKL)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     508683 (PFKL)
Protein phosphatases and associated proteins [BR:bta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     508683 (PFKL)
Messenger RNA biogenesis [BR:bta03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     508683 (PFKL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 508683
NCBI-ProteinID: NP_001073713
Ensembl: ENSBTAG00000010658
VGNC: 32773
UniProt: A1A4J1
Position
1
AA seq 780 aa AA seqDB search
MASVDLEKLRTTGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
GGENIKQANWLSVSNIIQLGGTVIGSARCKAFTTREGRRAAAYNLVQRGITNLCVIGGDG
SLTGANIFRSEWGSLLEELVSEGKISEGTAQTYSHLNIAGLVGSIDNDFCGTDMTIGTDS
ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
NFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPISSRYVKDLVVQRLGFDTRVTVLGHVQ
RGGTPSAFDRILSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQMTKEVQK
AMDEKRFDEAIQLRGGSFENNWNIYKLLSHQKISKEKTNFSLAILNVGAPAAGMNAAVRS
AVRSGISQGHTVYVVHDGFEGLAKNQVQEVSWHDVAGWLGRGGSMLGTKRTLPKGFMEKI
VENIRLHNIHALLVIGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
IQDLKANVEHMTEKMKTEIQRGLVLRNEKCHEHYTTEFLYNLYSSEGKGVFDCRTNVLGH
LQQGGAPTPFDRNYGTKLGVKAIIWMSEKLRAVYRNGRVFANASDSACVIGLQKKVVAFS
PVTELKKDTDFEHRMPREQWWLNLRLMLKMLAHYRISMADYVSGELEHVTRRTLSIETGF
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgtggatctggagaagctgcggaccaccggggctggcaaggccatcggcgtg
ctgaccagtggcggtgatgcgcaaggcatgaatgccgctgtcagagccgtgactcgtatg
ggcatttacgtgggggccaaggtcttcctcatctacgagggctatgaaggcctcgtggag
ggcggcgagaacatcaagcaggccaactggctgagcgtctccaacatcatccagttgggc
ggcaccgtcatcggcagcgcccgctgcaaggccttcaccacgcgggagggacgccgggcg
gccgcctacaacctggtccagcgtggcatcaccaacctgtgcgtcatcggcggggacggc
agcctcactggggccaacatcttccgcagcgagtggggcagcctcctggaggagctggtg
agcgaaggcaagatctcagagggcacggctcagacctattcacacctgaacatcgcgggg
ctggtgggctccatcgacaatgacttctgtggcaccgacatgaccatcggcacagactcg
gcgctgcaccgcatcatggaagtcatcgacgccatcaccaccactgcccagagccaccag
aggacctttgtgctggaggtgatgggacggcactgcgggtacctggccctggtgtctgcc
ctggcctcgggggccgactggctgttcatccctgaggcgccccctgaggacggctgggag
aacttcatgtgtgagcggctcggcgagactcggagccgagggtcccgcctcaacattatc
atcattgctgagggcgccatcgaccgcaacgggaagcccatctcgtcccgctacgtgaag
gacctggtggtccagagactgggcttcgacacgcgtgtgactgtgctgggccacgtgcag
aggggagggaccccctcggcattcgaccgcatcctgagcagtaagatgggcatggaggcg
gtgatggcgctgctggaggccacgcccgacacgccggcctgcgtggtcagcctctcgggg
aaccagtccgtgcggctgcccctcatggagtgtgtgcagatgaccaaggaggtgcagaag
gccatggacgagaagaggtttgacgaggccatccagctccgaggcgggagctttgagaac
aactggaatatttacaagctgctttcccaccagaagatctccaaggagaagaccaacttc
tccctggccatcctgaacgtgggggccccagcagccggcatgaacgcggccgtgcgctcg
gcggtgcgttctggcatctcccagggccacacggtgtacgttgtgcatgacggctttgaa
ggcctggccaagaaccaggtgcaagaagtgagctggcatgacgtggccggctggctgggg
cgtggtggctccatgctggggacaaagaggacgctgcccaaaggcttcatggagaaaatt
gtggaaaacatccgccttcacaacatccacgccctgctggtcatcgggggctttgaggcc
tacgagggggtgctgcagctggtggaggcccgtgggcgctatgaggagctgtgcatcgtc
atgtgcgtcatccccgccaccatcagcaacaacgtgccaggcacggacttcagcctgggc
tccgacacggccgtcaacgccgccatggagagttgtgaccgcatcaagcagtcggcctcg
gggaccaagcgccgtgtgttcatcgtggagaccatgggtggctactgcggctacctggct
actgtgactggcattgctgtgggcgccgacgctgcctatgtcttcgaggatcccttcaac
attcaagacttaaaggccaatgtggagcacatgaccgagaagatgaagacagagatccag
cggggcctggtactccggaacgagaagtgccacgagcactacaccacagagttcctgtac
aacctctactcctccgagggcaagggcgtgtttgactgcaggaccaacgtcctgggccac
ctgcagcagggtggagctcccaccccctttgaccggaactatggtaccaagctcggggtg
aaagccataatctggatgtcggagaagctgcgggcagtctatcgcaatgggcgggtgttt
gccaatgcctctgactcggcctgcgtgattggcctgcagaagaaagtggtggccttcagc
cctgtcaccgagctcaagaaagacaccgactttgagcaccgcatgccccgggagcagtgg
tggctgaacctgcggctcatgctgaagatgctggcacactaccgcatcagcatggctgac
tacgtgtccggggagctggagcacgtcacccgccgcaccctcagcattgagacgggcttc
tga

DBGET integrated database retrieval system