KEGG   Bos taurus (cow): 508867Help
Entry
508867            CDS       T01008                                 

Gene name
AP3S2
Definition
(RefSeq) AP-3 complex subunit sigma-2
  KO
K12399  AP-3 complex subunit sigma
Organism
bta  Bos taurus (cow)
Pathway
bta04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bta00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    508867 (AP3S2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bta04131]
    508867 (AP3S2)
Membrane trafficking [BR:bta04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    508867 (AP3S2)
 Endosome - Golgi transport
    508867 (AP3S2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clat_adaptor_s
Motif
Other DBs
NCBI-GeneID: 508867
NCBI-ProteinID: NP_001068844
BGD-bta: BT20343
Ensembl: ENSBTAG00000001407
UniProt: Q1JQA3
Position
21
AA seq 193 aa AA seqDB search
MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSD
YKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYIL
QEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEMPRNINIG
DLNIKVPNLSQFV
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgattcaggcgattctggttttcaataaccacgggaagccgcggctggtccgcttctac
cagcgtttcccagaagaaattcagcagcagattgttcgagagacctttcatctagttctc
aagcgggatgacaacatctgtaacttcttggagggtggaagtttgattggtggctctgac
tacaaactgatttatcggcattatgctaccctctactttgtattttgtgtggattcctca
gaaagtgaacttgggatcttggacctcatccaggttttcgtggagactctggacaagtgt
tttgagaatgtttgtgaattggatttgatcttccatatggataaggtacactacatcctt
caggaggtggtgatgggtgggatggtcctggaaacaaacatgaatgagatcgtggctcag
attgaagcccagaacaggctggagaagtccgagggtggcctttcagccgcacctgcccgg
gcggtgtccgctgtgaagaacatcaacctgccagagatgccccggaacatcaacattggc
gatctcaacatcaaggtccccaacctgtcccagtttgtctga

DBGET integrated database retrieval system