KEGG   Bos taurus (cow): 509200Help
Entry
509200            CDS       T01008                                 

Gene name
HNF4A
Definition
(RefSeq) hepatocyte nuclear factor 4-alpha
  KO
K07292  hepatocyte nuclear factor 4-alpha
Organism
bta  Bos taurus (cow)
Pathway
bta04152  AMPK signaling pathway
bta04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    509200 (HNF4A)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04950 Maturity onset diabetes of the young
    509200 (HNF4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bta03000]
    509200 (HNF4A)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:bta03310]
    509200 (HNF4A)
Transcription factors [BR:bta03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    509200 (HNF4A)
Nuclear receptors [BR:bta03310]
 2. Hepatocyte nuclear factor 4 like
  2A. Hepatocyte nuclear factor 4 receptor
   509200 (HNF4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 509200
NCBI-ProteinID: NP_001015557
BGD-bta: BT27631
Ensembl: ENSBTAG00000012116
VGNC: 29891
UniProt: Q7YRQ5
Position
13
AA seq 455 aa AA seqDB search
MDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGANLNAPNSLGVSALCAICGDRATG
KHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEA
VQNERDRISTRRSSYEDSSLPSINALLQAEVLSQQITSPVSGINGDIRAKKIASIADVCE
SMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDY
IVPRHCPELAEMSRVSVRILDELVLPFQELQIDDNEYACLKAIIFFDPDAKGLSDPGKIK
RLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNL
LQEMLLGGSSSEAPHAHHPLHPHLMPEHMGTNVIVANTMPAHLSNGQMSTPETPQPSPPG
GSGSEPYKLLPGAIATIVKPPSAIPQPTITKQEVI
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggacatggccgactacagtgccgcgttggacccagcctacaccaccctggagtttgag
aatgtgcaggtgttgacgatgggcaatgacacatccccatcagagggtgccaacctcaac
gcacccaacagcctgggtgtcagtgccctgtgcgccatctgcggggaccgggccacgggc
aaacactacggtgcctcgagctgtgacggctgcaagggctttttccggagaagtgtgagg
aagaaccacatgtactcctgcaggtttagccggcagtgcgtggtggacaaagacaagagg
aaccagtgccgctactgcaggctcaagaagtgcttccgggctggcatgaagaaggaagct
gtacagaatgaacgggaccggatcagcactcgccggtccagctacgaggacagcagcctg
ccctccatcaatgcgctcctgcaggctgaggtcctgtcccagcagatcacctcccctgtc
tccggaatcaacggcgacattcgggcgaagaagatcgccagcatcgcggatgtgtgtgag
tccatgaaagagcagctgctggtgctcgtcgagtgggccaagtacatcccagccttctgt
gagctccccctggacgaccaggtggccctactcagagcccacgccggcgagcacctgctt
ctcggagccaccaagcgctccatggtgttcaaggatgttctgcttctaggcaatgactac
atcgtccctcggcactgcccggagctggcagagatgagtcgagtgtccgtgcgcatcctt
gatgagttggtgctgccctttcaagagctgcagattgacgacaacgagtacgcctgcctc
aaagccatcatcttctttgacccagatgccaaggggctgagtgacccgggcaagatcaag
aggctgcgttcccaggtgcaggtgagcctggaagactacatcaacgaccgccagtacgac
tcgcgtggccgcttcggcgagctgctgctgctgctgcccaccctgcagagcatcacctgg
cagatgatcgagcagatccagttcatcaagctcttcggcatggccaagatcgacaacctg
ctgcaggagatgctgctgggagggtcctccagtgaagcacctcatgcccaccaccccctg
caccctcacctgatgccagagcacatgggcaccaacgtcattgttgccaacacgatgcct
gctcacctcagcaacggacagatgtccacccctgagactccacagccttcaccgcctggt
ggttcagggtccgagccctacaagcttctgcccggagctattgccaccatcgtcaagccc
ccctctgccatcccgcagccgaccatcaccaagcaggaagtcatctag

DBGET integrated database retrieval system