KEGG   Bos taurus (cow): 509209Help
Entry
509209            CDS       T01008                                 

Gene name
ACSF3
Definition
(RefSeq) acyl-CoA synthetase family member 3, mitochondrial precursor
  KO
K18660  malonyl-CoA/methylmalonyl-CoA synthetase [EC:6.2.1.-]
Organism
bta  Bos taurus (cow)
Pathway
bta00280  Valine, leucine and isoleucine degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    509209 (ACSF3)
Enzymes [BR:bta01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     509209 (ACSF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 509209
NCBI-ProteinID: NP_001030240
BGD-bta: BT26283
Ensembl: ENSBTAG00000015968
VGNC: 25563
UniProt: Q58DN7
Position
18
AA seq 586 aa AA seqDB search
MPLPYVGMALRRLAWAVASCRLAPWTRGASGPLHSAPAARSDCSAPVFIRAPAFGDRLAL
IDQHGRHTYKDLYLRSLRLSREICQLRACADGDLREERVSLLCSNDVSFVVAQWAAWMSG
GVAVPLYRKHPRAQLEYFIQDSRSSVVLAGPEHVELLSPVAQKLGVPLLPLPPTVYHGVA
EDPEEGLVLERNWRDRGAMIIYTSGTTGRPKGVLSTHDNIRAVVTGLVHKWAWTKDDVIL
HVLPLHHVHGVVNKLLCPLWVGATCVMLPEFSAQLVWEKFLSSEAPQINVFMAVPTIYSK
LMDYYDKHFTQPHVQDFVRAVCEEKIRLMVSGSAALPLPVLEKWKGITGHTLLERYGMTE
IGMALSNPLTAARLPGSVGTPLPGVEVRIVSENPQKDSSPYLIHAEGSEENTKVTPGFEE
KEGELLVRGPSVFREYWDKPEETKAAFTSDGWFKTGDTVVFKDGCYWIRGRTSVDIIKSG
GYKVSALEVERLLLAHPSITDVAVIGVPDMTWGQRVTAVVTLQEGHSLSHRELKEWARGV
LAPYAVPSELLLVEEIPRNQMGKVNKRDLVRQLYPHEKGAPEAGSQ
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgccattgccatacgtggggatggccctccggcgcctagcctgggccgtggcttcctgc
cggctggccccctggacacgtggagcaagtggccccctgcactcggccccggccgcacgc
tcggactgcagtgccccggtcttcatccgcgccccagccttcggggacaggctcgccctc
attgaccagcacggccgccacacgtataaggacctctacttgcgcagcctccgcctatcc
cgggagatctgccagctccgcgcgtgtgccgatggggacctccgggaggagcgggtctcc
ctcctgtgctccaacgacgtctcctttgtggtggcacagtgggccgcgtggatgagcggc
ggcgtggccgtccccctctacaggaagcacccccgggcccagctggagtacttcatccag
gactcgcgcagctccgtggtccttgccggcccagagcacgtggagcttctaagcccggtg
gcccagaagctcggagtcccgctcctgcctctcccgcccacagtctaccatggggtagcc
gaggaccctgaagagggcctggtgctggagcggaactggagagaccggggtgccatgatc
atctacaccagtgggaccacggggaggcccaagggcgtcctgagcacccatgacaacatc
agggccgtggtgacggggctggtccacaagtgggcctggacaaaggacgacgtgatcctc
catgtcctcccgctgcaccacgtccatggcgtggtcaacaagctgctgtgcccactctgg
gtaggggccacctgtgtgatgctgcccgagttcagtgctcagttggtttgggagaagttc
ttaagttctgaagctccccagattaatgtatttatggcagtgcctaccatctacagcaag
ttgatggattattatgacaagcattttacccagcctcatgtccaggattttgtgcgtgca
gtttgtgaagaaaaaatcaggttgatggtctcgggctctgctgcgctgcccctgccagtg
ctggagaaatggaagggcatcaccggccacactctgctggagaggtacgggatgacggag
attggcatggccctgtccaaccccctgaccgcagctcgcctgccaggctctgtggggacc
ccgctgcccggcgttgaggtgcgcattgtgtcggaaaacccacagaaggacagctccccc
taccttatccacgcagaaggaagtgaggagaataccaaggtgaccccagggttcgaggag
aaagagggcgaactcctggtcagggggccctctgtgtttcgagaatactgggacaagccg
gaggaaacgaaagccgccttcacctcagacggctggttcaaaacaggtgacacggtagtg
ttcaaggatggctgctactggatccgtggccgcacctctgtggatatcatcaagagcggc
ggctacaaggttagcgccctggaagtggagcggctcctgctggcccaccccagcatcacc
gacgtggctgtgattggagttccagacatgacatggggccagcgggtcaccgcagtggtg
acccttcaagagggccactcgctgtcccaccgggagctcaaggagtgggccagaggcgtc
ctggccccatacgctgtgccctcggagctgctgctggtggaggagatcccgcggaaccag
atggggaaggtcaacaagcgagacctcgtccggcagctttacccgcatgagaagggcgcc
cccgaggccgggagccagtga

DBGET integrated database retrieval system