KEGG   Bos taurus (cow): 509227Help
Entry
509227            CDS       T01008                                 

Gene name
FRK
Definition
(RefSeq) tyrosine-protein kinase FRK
  KO
K08892  fyn-related kinase [EC:2.7.10.2]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bta01001]
    509227 (FRK)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     509227 (FRK)
Protein kinases [BR:bta01001]
 Non-receptor tyrosine kinases
  SRC family
   509227 (FRK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_2 SH3_9 Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 509227
NCBI-ProteinID: XP_002690130
BGD-bta: BT24360
Ensembl: ENSBTAG00000020018
VGNC: 29112
Position
9
AA seq 514 aa AA seqDB search
MGNLCLRLWTYLDRCFPCWWSEEVDKPGVIQNPWADCPPDPPRLPAPEPERSQGQFFVAL
FDYQARTAEDLSFHAGDKLQVLDKSHKGWWLARHLEKRADSSSQQLQGYIPSNYVAEDRS
LQAEPWFFGAIKRTDAEKQLLYSENQTGAFLIRESESQKGDFALSVLDEGVVKHYRIRRL
DEGGFFLTRRRTFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQWEID
RSSIQLLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPNDFLREAQIMKNLRHPKLI
QLYAVCTLEDPIYIITELMRHGSLQEYLQNDAGSKIHLTQQVDMAAQVASGMAYLESQNY
IHRDLAARNVLVGEHNIYKVADFGLARVFKVENEDIYESKHEIKLPVKWTAPEAIRTNKF
SIKSDVWSFGILLYEIITYGKMPYSGMTGAQVIQMLGQNYRLPQPSNCPLQFYNIMLECW
NAEPKDRPTFETLHWKFEDYFVTESSYSDTNNFL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacctctgcctgaggctctggacctacctggatcgttgtttcccctgctggtgg
tctgaggaggtggacaagcctggggtgattcagaacccatgggctgactgccctcctgat
cctccccggctgccagctccagagcccgagagaagccagggccagttctttgtggctcta
tttgattaccaggctcggacagctgaggacctgagcttccacgcgggtgacaagctccaa
gtcctagacaagtcccacaagggctggtggctggccaggcacttggagaaaagggccgac
agctccagccagcagctgcagggctacattccttctaactacgtggctgaagacaggagc
ctccaggcagagccgtggttctttggagcaatcaagagaacagatgctgaaaaacagcta
ttatattcagaaaaccagacgggagcttttctaatcagagaaagtgaaagtcagaaaggc
gatttcgccctttcagttttagatgaaggggttgtgaaacactacagaatcagaagactg
gatgaagggggctttttcctcacccggagaagaaccttttcaacactgaatgaattcgtg
agtcattacaccaagacaagtgatggcctgtgtgtcaagctgggaaaaccatgcttaaag
atacaagttccagctccctttgatttgtcatataaaactgtggaccagtgggagattgac
cgcagctccatacaacttttgaagcgattaggatctggtcagtttggtgaagtgtgggaa
ggcctgtggaacaataccactccggtagcagtaaaaacattaaagccaggttcaatggat
ccaaatgacttcctgagggaggcacagataatgaagaacctaagacatccaaagcttatc
cagctttatgctgtttgcactttagaagatccaatttatattattacagagttgatgaga
catggaagtctgcaagaatatctccaaaatgatgctggatcaaaaatccatctgacgcag
caggtagacatggcagcccaggttgcctctggaatggcctatttggaatcccagaactat
attcatagagatttggctgccagaaatgtccttgttggggaacataatatctacaaagtg
gcagattttggacttgccagagtttttaaggtagagaatgaagacatctatgaatctaaa
cacgaaataaagctgccggtgaagtggactgcgcctgaagccattcgtactaataaattc
agcattaagtccgatgtgtggtcatttggaatccttctttatgaaatcattacttatggc
aaaatgccttatagtggtatgacaggtgctcaggtaatccagatgttgggtcaaaactat
agactccctcaaccatctaactgtccattgcaattctacaatatcatgttggagtgctgg
aatgcagagcctaaggaccggccaacatttgaaacactgcactggaaatttgaggattat
tttgtaacagagtcttcatattcggatacaaataactttctatga

DBGET integrated database retrieval system