KEGG   Bos taurus (cow): 509274
Entry
509274            CDS       T01008                                 

Gene name
HAGH
Definition
(RefSeq) hydroxyacylglutathione hydrolase, mitochondrial
  KO
K01069  hydroxyacylglutathione hydrolase [EC:3.1.2.6]
Organism
bta  Bos taurus (cow)
Pathway
bta00620  Pyruvate metabolism
bta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    509274 (HAGH)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.6  hydroxyacylglutathione hydrolase
     509274 (HAGH)
SSDB
Motif
Pfam: HAGH_C Lactamase_B Lactamase_B_2
Other DBs
NCBI-GeneID: 509274
NCBI-ProteinID: NP_001030351
BGD-bta: BT16399
Ensembl: ENSBTAG00000019998
VGNC: 29742
UniProt: Q3B7M2 M5FMT6
Position
25
AA seq 308 aa
MVLGRGLLGRWSVAELGAVCARLGLGPALLGSLHHLGLRKSLTVDQGTMKVELLPALTDN
YMYLLIDEDTKEAAIVDPVQPQKVVETARKHGVKLTTVLTTHHHWDHAGGNEKLVKLEPG
LKVYGGDDRIGALTHKVTHLSTLQVGSLHVKCLSTPCHTSGHICYFVTKPNSPEPPAVFT
GDTLFVAGCGKFYEGTADEMYKALLEVLGRLPADTRVYCGHEYTINNLKFARHVEPDNTA
VREKLAWAKEKYSIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETEPVATMRAIRKEK
DQFKMPRD
NT seq 927 nt   +upstreamnt  +downstreamnt
atggtgctgggccgcgggctgctcggccgctggagcgtcgcagagctgggagccgtctgc
gctcgtctcggcctgggtccagccctgctgggaagcctccaccacttgggtttaaggaag
agcttgaccgtggatcagggcaccatgaaggtggagttactgccggctctgaccgacaat
tacatgtacctgctcattgatgaggacaccaaggaggcggccattgtggatccggtgcag
ccccagaaggtggtggaaacggcgaggaagcacggcgtgaagctgaccacagtgctcacc
acccaccaccactgggaccacgctggcgggaacgagaagctggtcaagctggaacctggg
ttgaaggtgtacgggggtgatgaccggattggggccctgactcacaaggtcacacacctg
tccacactgcaggtggggtctctccatgtcaagtgcctgtcgacgccgtgtcacacttcc
ggacacatctgttactttgtgaccaagcccaacagtcccgagccgcccgctgtgttcaca
ggtgacaccttgtttgtggccggctgcgggaagttctatgaagggacagcggatgagatg
tacaaagccctgctcgaggtcctgggccggctccctgcagacacgagagtgtactgtggc
catgaatacaccatcaacaacctgaagtttgctcgccacgtggagcccgacaacactgcc
gtccgggagaaactggcctgggccaaggagaagtacagcatcggggagcccacggtgcca
tccaccatcgccgaggagttcacctacaacccattcatgcgagtgagggagaagacggtg
cagcagcacgcgggcgagacggagcctgtggccaccatgagggccatccgcaaagagaag
gaccagttcaagatgccgcgggactag

DBGET integrated database retrieval system