KEGG   Bos taurus (cow): 509459Help
Entry
509459            CDS       T01008                                 

Gene name
CPT1B
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, muscle isoform
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
bta  Bos taurus (cow)
Pathway
bta00071  Fatty acid degradation
bta01212  Fatty acid metabolism
bta03320  PPAR signaling pathway
bta04152  AMPK signaling pathway
bta04714  Thermogenesis
bta04920  Adipocytokine signaling pathway
bta04922  Glucagon signaling pathway
bta04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    509459 (CPT1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    509459 (CPT1B)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    509459 (CPT1B)
   04920 Adipocytokine signaling pathway
    509459 (CPT1B)
   03320 PPAR signaling pathway
    509459 (CPT1B)
  09159 Environmental adaptation
   04714 Thermogenesis
    509459 (CPT1B)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    509459 (CPT1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bta03029]
    509459 (CPT1B)
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     509459 (CPT1B)
Mitochondrial biogenesis [BR:bta03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    509459 (CPT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N DUF3128
Motif
Other DBs
NCBI-GeneID: 509459
NCBI-ProteinID: NP_001029521
BGD-bta: BT10800
Ensembl: ENSBTAG00000016048
VGNC: 27677
UniProt: Q58DK1
Position
5
AA seq 771 aa AA seqDB search
MAEAHQAVAFQFTVTPEGVDFQLSREVLKHIYLSVIRSWKKRLIRIKNGILRGVYPGSPT
SWLVVVMATAGSSYYNVDISMGLVYYIQRWLPEGRPYRTPYTRTLFSMAIFSTGVWMMGI
FFFRQTLKLLLSYHGWMFELHGQTSHLTRVWAVCVRLLSGRRPMLYSFQTSLPKLPVPSV
PATVHRYLESVEHLLDDEQYYRMETLAKEFEEKTAPRLQKYLVLKSWWATNYVSDWWEEY
VYLRGRNPIVVNSNYYVMDLVLVKNTDVQAARLGNAVHAMITYRRKLDREEIKPVMALGL
VPMCSYQMERMFNTTRIPGKDTDVLQHLPDSRHVAVYHKGRFFKVWLYEGSRLLKPRDLE
MQFQRILDDPSPPQPGEERLAALTAGGRVEWAQARQAFFSSGKNKAALDAIERAAFFVAL
DEESHHYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNTEHAWADAPII
GHLWEFVLGTDSFHLGYTETGHCLGKPNPVLPPPQRLQWDIPKQCQAVIESSYQVAKALA
DDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREGR
TETVRSCTRESTAFVQAMVQGRHLNEDLQRLFRKAAEKHQNMYRLAMTGAGIDRHLFCLY
VVSKYLGVESPFLAEVLSEPWRLSTSQIAQFQIRMFDPNKYPKHLGAGGGFGPVADDGYG
VSYMIAGENTIFFHVSSKFSSSETNAQRFGNQIRQALLDIANLFQVPKADG
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcgcaccaggctgtggccttccagttcactgtgaccccagagggggtcgac
ttccagctcagtcgggaggtgctgaaacacatctacctgtccgtgatcaggtcctggaag
aaacgcctgattcgcatcaagaatggcatcctcaggggcgtgtaccctggcagccccacc
agctggctggtcgtggttatggcaacagcgggttcctcctactacaacgtggacatttcc
atgggcctggtctattatatccagagatggcttcctgaggggcgtccctaccggacccca
tacacccggacgcttttcagcatggccatcttctccacgggggtctggatgatgggcatc
ttcttctttcgccaaaccctgaaactgcttctttcctaccacggttggatgtttgagttg
cacggccagaccagccacttgaccagagtctgggctgtctgtgtccgccttctgtctggc
cgacggcccatgctctacagcttccagacgtctctgcccaagctgccggtgcccagcgtg
ccagccacagttcatcggtacctagaatccgtggaacacttgctggatgatgagcaatat
tatcgaatggagacgctggccaaggagttcgaggagaagactgcccccaggctgcagaag
tacctggtactcaagtcctggtgggcaaccaactacgtgagcgactggtgggaggagtac
gtctacctccggggcaggaaccccatcgtggtcaacagcaactactacgtcatggacctg
gtgctcgtcaagaacacggacgtgcaggctgcccgcctgggaaatgctgtccacgccatg
atcacgtatcgccgtaaactggaccgtgaagagatcaagcctgtgatggcgctgggcctc
gtgcccatgtgctcctaccagatggagaggatgttcaacaccactcgcatcccagggaag
gacacagatgtgctccagcacctcccggacagcaggcacgtggctgtctaccacaagggc
cgatttttcaaggtgtggctctacgagggctcccgcctgctcaagcctcgggacctggag
atgcagttccagaggatcctggacgacccctccccaccccagcccggggaggagagactg
gcagccctcactgcagggggaagagtggagtgggcacaggcacgccaggccttcttcagc
tctggcaagaacaaggctgccctggatgccatcgagcgcgctgcgttcttcgtggctctg
gatgaggagtctcaccactatgacccggaggacgaggccagcctcagcctctacggcaag
gccctgttgcacggcaactgctacaacaggtggttcgacaagtccttcacactcatctct
ttcaagaacggccagctgggactcaacacagagcacgcgtgggcagacgcccctatcata
gggcacctctgggagtttgtcctgggcaccgactccttccatctgggctacacagagacg
gggcactgtctgggcaaacccaaccctgtgctgcccccacctcagcgactccagtgggac
attcctaagcagtgccaggcggtcatcgagagttcctaccaggtggccaaggcgctggcg
gacgatgtggagctgtactgcttccagttcctgccttttggcaaaggcctcatcaagaag
tgccggaccagccctgacgccttcgtgcagatcgccctgcagctggcgcacttccgggac
aggggcaagttctgcctgacctatgaagcctcaatgactagaatgttccgagagggccgg
acggagaccgtgcgctcctgcacccgcgagtccacagcctttgtccaggccatggtgcag
gggcgccacctgaacgaagacctccaacgtctgttccggaaggctgctgagaagcaccag
aatatgtaccgcctggccatgacaggggcggggattgacaggcacctcttctgcctttac
gtggtctccaagtacctgggagtcgaatcccctttcctggctgaggtgctctcagaaccc
tggcgcctctccactagccagatcgctcaattccagatccgtatgttcgacccaaacaag
taccccaaacaccttggtgccggcggtggctttggccctgtggcagatgatggctatgga
gtttcctacatgatcgcgggtgagaacaccatcttcttccacgtctccagcaagttctcc
agctcagagacaaatgcccagcgctttgggaaccagatccgccaagctctgctagacatc
gccaatcttttccaagttcccaaggctgatggctaa

DBGET integrated database retrieval system