KEGG   Bos taurus (cow): 509522
Entry
509522            CDS       T01008                                 

Symbol
FUCA1
Name
(RefSeq) tissue alpha-L-fucosidase precursor
  KO
K01206  alpha-L-fucosidase [EC:3.2.1.51]
Organism
bta  Bos taurus (cow)
Pathway
bta00511  Other glycan degradation
bta04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    509522 (FUCA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    509522 (FUCA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    509522 (FUCA1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.51  alpha-L-fucosidase
     509522 (FUCA1)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   509522 (FUCA1)
SSDB
Motif
Pfam: Alpha_L_fucos Fucosidase_C GHL6
Other DBs
NCBI-GeneID: 509522
NCBI-ProteinID: NP_001039500
BGD-bta: BT25540
Ensembl: ENSBTAG00000030434
VGNC: 29140
UniProt: Q2KIM0
Position
2
AA seq 468 aa
MRSWVVGARLLLLLQLVLVLGAVRLPPCTDPRHCTDPPRYTPDWPSLDSRPLPAWFDEAK
FGVFVHWGVFSVPAWGSEWFWWHWQGEKLPQYESFMKENYPPDFSYADFGPRFTARFFNP
DSWADLFKAAGAKYVVLTTKHHEGYTNWPSPVSWNWNSKDVGPHRDLVGELGTAIRKRNI
RYGLYHSLLEWFHPLYLRDKKNGFKTQYFVNAKTMPELYDLVNRYKPDLIWSDGEWECPD
TYWNSTDFLAWLYNDSPVKDEVVVNDRWGQNCSCHHGGYYNCKDKFQPETLPDHKWEMCT
SIDQRSWGYRRDMEMADITNESTIISELVQTVSLGGNYLLNVGPTKDGLIVPIFQERLLA
VGKWLSINGEAIYASKPWRVQSEKNSVWYTSKGLAVYAILLHWPEYGILSLISPIATSTT
KVTMLGIQKDLKWSLNPSGKGLLVFLPQLPPAALPTEFAWTIKLTGVK
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgaggtcgtgggtggtcggcgcccggctgctgcttttgctgcagctggtgctggtgctc
ggagcggtgcggctcccaccctgcaccgaccctcggcactgcaccgaccctccgcgctat
accccggactggcctagtctggactcccggccgctgccggcctggttcgatgaagccaaa
ttcggggtgttcgtgcactggggcgtgttttcggtgcccgcctggggcagcgagtggttc
tggtggcactggcagggcgagaagctgccacagtacgagagcttcatgaaagagaactac
ccgccggatttcagctacgccgacttcgggccaaggttcacggcgcgcttcttcaacccc
gacagctgggctgacctcttcaaggccgctggggccaagtatgtagtcctgacgacaaag
catcacgaaggctacacaaactggccaagccctgtgtcttggaactggaactctaaggat
gtggggccccatcgtgatttggttggtgagttgggaacagccatccggaagaggaacata
cgctatggactgtatcactcacttttagaatggttccatcctctctacctacgtgataag
aaaaatggctttaaaacccagtacttcgtcaatgcaaaaacaatgccagagctctatgac
cttgttaacaggtataaacctgacttgatttggtctgatggagagtgggaatgtcctgac
acttactggaactctacagattttcttgcttggctctacaatgatagcccagttaaggat
gaggtcgtagtgaatgaccgatggggtcagaactgctcctgtcatcatggaggatactac
aactgtaaagataaattccagccagagaccttgccagatcacaagtgggagatgtgcacc
tccatagaccagcggtcctggggctaccgtcgagacatggagatggctgacatcacaaac
gaatccacgatcatttcggaactggttcagacagtaagtttgggaggcaactatcttctc
aacgtcggaccaaccaaagacggactgatcgttcccatcttccaagaaaggctacttgct
gttgggaagtggctgagcatcaatggagaggctatctatgcctccaaaccatggagagta
caatctgagaagaactctgtatggtatacgtctaaaggattagctgtttatgccatttta
ctgcactggccagaatatggaatcttaagccttatatcccctatagctacttcaaccaca
aaggtaacaatgctgggaatccaaaaggatctgaagtggtccctaaatccctcaggtaaa
ggtctcctcgtgttcctgccccagttaccacccgctgctcttccaactgagtttgcttgg
accataaagctgacaggagtgaagtga

DBGET integrated database retrieval system