KEGG   Bos taurus (cow): 509591
Entry
509591            CDS       T01008                                 

Gene name
RBMX
Definition
(RefSeq) RNA-binding motif protein, X chromosome
  KO
K12885  heterogeneous nuclear ribonucleoprotein G
Organism
bta  Bos taurus (cow)
Pathway
bta03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    509591 (RBMX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bta03041]
    509591 (RBMX)
Spliceosome [BR:bta03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    509591 (RBMX)
SSDB
Motif
Pfam: RRM_1 RBM1CTR RRM_7 RRM_5 RRM_occluded PHM7_cyt
Other DBs
NCBI-GeneID: 509591
NCBI-ProteinID: NP_001165510
BGD-bta: BT23311
Ensembl: ENSBTAG00000013308
UniProt: D3JUI8
Position
X
AA seq 391 aa
MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPA
DAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSGGTR
GPPSHGGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGMGGR
APVSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPPRD
YTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPPTRGP
PPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPP
RDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggttgaggcagatcgcccaggaaagctctttatcggtggcctcaatacagaaaccaat
gagaaagcccttgaagcagtatttggcaaatatggacgaatagtggaagttctcttgatg
aaagatcgtgaaaccaacaaatctagaggatttgcttttgtcacctttgaaagcccagca
gatgctaaggatgcagccagagacatgaatggaaagtccttagatggaaaagccatcaag
gtagaacaagccactaaaccgtcatttgaaagtggtagacgtggaccacctccacctcca
agaagcagaggccctcccagaggccttcggggaggaagaggaggaagtggaggaaccagg
ggacctccatcccatggagggcacatggatgatggtggctattccatgaattttaacatg
agttcttccaggggaccacttccggtaaaaagaggaccaccaccacgaagtgggggtcct
cctcctaaaagatctgccccttcaggaccagttcgaagcagcagtggaatgggaggaaga
gctcctgtatcacgtggaagagatagttatggaggtccacctcgaagggagcccttgccc
tctcgtagagatgtttatttgtccccaagagatgatggatattctactaaagacagctat
tcaagcagagattacccaagttctcgtgatacaagagattatgcaccaccaccaagagat
tatacttaccgtgattatggtcattccagttcacgtgatgactatccatcaagaggctat
agtgatagagatggctatggtcgtgatcgtgactattcagatcatccaagtggaggttcc
tacagagattcatatgagagttatggtaactcacgtagtgctccacctacacgagggccc
ccgccatcttatggtggaagcagtcgctatgatgattacagcagctcacgtgacggatat
ggtggaagtcgagacagttactcaagcagccgaagtgatctctactcaagtggtcgtgat
cgggttggcagacaagaaagagggcttcccccttctatggaaagggggtaccctcctcca
cgagattcctacagcagttcaagccgcggagcaccaagaggtggtggccgtggaggaagc
cgatctgatagagggggaggcagaagcagatattaa

DBGET integrated database retrieval system