KEGG   Bos taurus (cow): 509838Help
Entry
509838            CDS       T01008                                 

Gene name
FRS3
Definition
(RefSeq) fibroblast growth factor receptor substrate 3
Organism
bta  Bos taurus (cow)
SSDB OrthologParalogGFIT
Motif
Pfam: IRS
Motif
Other DBs
NCBI-GeneID: 509838
NCBI-ProteinID: NP_001092388
BGD-bta: BT19606
Ensembl: ENSBTAG00000009861
VGNC: 29121
UniProt: A6H792
Position
23
AA seq 495 aa AA seqDB search
MGSCCSCLNRDSVSDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIIT
RNSHPAELDLPRAPQPPNALGYTVSSFSNGFPGCPGEGPRFSAPRRPSTSSLRHPSLGEE
STHALIAPDEQSHTYVNTPAGEEEQRRSRHCLQPLPEGRAPFTPQARGPDQRDPQVFLQP
GQVKFVLGPTPARRHMTKCQGLCPSLQDAPHHNNNNEGPSECPAQPKCTYENVSGGLRPG
AGWRLSPEEPGWNGLAQRRAALLHYENLPSLPPVWESQAPQPGEEAGDDGDSRDGLTPSS
NGFPEGEEDETPLQKPTSTRAALRSHGSFPVPLTRRRGSPRVFNFDFRRPGPEPPRQLNY
IQVELKGWGGDRPKGPPNPSAPRAPVPTTHPTRSSDSYAVIDLKKTVAMSNLQRALPRDD
GTARKTRHNSTDLPL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggggagctgctgcagctgcctgaaccgagacagcgtctcagacaaccaccccaccaag
ttcaaggtgacgaatgtggatgatgagggggtggagctgggctccggagtgatggagctg
acccagagtgagctggtgctgcacctgcatcggcgcgaggccgtccgctggccttacctc
tgcctgaggcgctatggctacgactccaacctcttctcttttgagagtggccggcggtgt
cagactggccaggggatatttgcatttaagtgctccagggctgaggaaatcttcaacctc
ctccaggatttgatgcagtgcaacagcatcaatgtgatggaagagccagtcatcatcacc
cgcaacagccacccggctgagcttgacctccctcgggccccccagcctcccaatgctcta
ggctatactgtctccagcttctccaatggcttccctggctgcccaggggagggtccccga
ttctcagcaccccggcgcccctcaacgagcagcctccgccacccctcgcttggtgaagag
tccacccatgccctcattgccccagatgagcagtcccacacctacgtcaacacgccagcc
ggcgaagaggagcagcgccgaagccggcactgcctgcagcccctgcctgagggccgggcg
cccttcacgccacaggcccggggccccgaccagcgggacccacaggtgttcctgcagccg
ggccaggtgaagttcgtgttgggccccaccccagctcggcggcacatgaccaagtgccaa
ggcctgtgcccgagcctgcaggacgccccccaccacaacaataacaacgagggcccttcg
gagtgcccggcccagcccaagtgcacctacgagaacgtcagcgggggtttgcggccaggg
gcgggctggagactgagcccggaggagccgggctggaacggcctggcccagcgccgggct
gcactactgcactatgaaaacctgccctccctgccccccgtgtgggagagccaggccccg
cagccaggggaggaggccggggatgacggtgactcaagggacgggctcacaccctcctcc
aacggcttcccggaaggcgaggaggacgagaccccgctgcagaagcccaccagcacccgg
gctgccctccgcagccacggcagcttccccgtgccgctgacccggcgccgaggctccccg
agggtcttcaactttgatttccgccggccgggcccggagcccccaaggcagctcaactac
atccaggtggagctgaagggctggggtggagaccgccccaaggggcccccgaacccttcc
gccccccgagcccctgttcccaccacgcacccgacccgcagctcagactcctacgccgtg
atcgacctcaaaaagaccgtggccatgtccaacctgcagagggcgctgccccgcgacgac
gggaccgctcggaaaacccggcacaacagcaccgacctgcctctgtag

DBGET integrated database retrieval system