KEGG   Bos taurus (cow): 510065Help
Entry
510065            CDS       T01008                                 

Gene name
ACOX3
Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 3
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
bta  Bos taurus (cow)
Pathway
bta00071  Fatty acid degradation
bta00410  beta-Alanine metabolism
bta00592  alpha-Linolenic acid metabolism
bta00640  Propanoate metabolism
bta01040  Biosynthesis of unsaturated fatty acids
bta01100  Metabolic pathways
bta01212  Fatty acid metabolism
bta03320  PPAR signaling pathway
bta04024  cAMP signaling pathway
bta04146  Peroxisome
Module
bta_M00087  beta-Oxidation
bta_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    510065 (ACOX3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    510065 (ACOX3)
   00592 alpha-Linolenic acid metabolism
    510065 (ACOX3)
   01040 Biosynthesis of unsaturated fatty acids
    510065 (ACOX3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    510065 (ACOX3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    510065 (ACOX3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    510065 (ACOX3)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    510065 (ACOX3)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     510065 (ACOX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_ox_N
Motif
Other DBs
NCBI-GeneID: 510065
NCBI-ProteinID: NP_001096706
Ensembl: ENSBTAG00000004893
VGNC: 25554
UniProt: A4IFA4
Position
6
AA seq 700 aa AA seqDB search
MAPLRESSGDPVLPDPPQGPLHVARARASFPWKELALFWEGEDTLRFKKAIFSALENDPL
FAHPRGSRLSVEKYQELNFLRCKRVFEYDFLPVGDMLDSLPRVLALIECLGMYDWSLAVK
FFLHVLTFGSAIYSSGSERHLKYLPKIFSLEIFGCFALTEVSHGSNTKGIRTTAHYDPST
QEFIIHSPDFEAAKFWVGNMGKTATHAVVFAQLYTPGGQCHGLHPFLVQIRDPKTLLPMP
GVMVGDIGKKLGQNGLDNGFAMFHKVRIPRQDLLNRSGDVTPEGAYVTHVKDVGQRFSES
LGSLSSGRVAIVGMSVVNLKLAVSIALRFSATRRQFGPTDKEEVPVLQYPMQQWRLLPYL
AAAYALDHFFKSLFLDLGELQQGLLGKDRSVRQAELGREIHALSSAGKPLASWTAQRGIQ
ECREACGGHGYLAMNRLGDLRDDNDPNCTYEGDNSVLLQQTSRYLLGLLARRGPGGARIE
SPLKTVDFLDGYADILGRRFEGSSPEDLLDSSVPLAAYEWLVCYLLRESHQKLSREKRSG
KSDFEAINDCQVYHCRPLALAFLELTVVRRFHEHTHQPRVPPPLRAVLRRLSALYALWSL
SQHTALLYRGGYFSGERAGKVLESAILALCAQLKDDAVALVDVIAPPDFILDSPIGRADG
ELYKNLWTAVLQENKVLERASWWAEFAVNKPVIGSLKPKL
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccctcagggagagcagcggtgaccccgtgctgccggacccgccccaggggccc
ctgcacgtggcccgcgcccgcgcttcattcccctggaaggagctggcgctgttctgggag
ggcgaagacacgctgcgcttcaagaaagccatcttctcggctctggagaacgaccccctc
ttcgcccatccccgtggcagccggctctcggtggagaagtaccaggagctgaacttcctg
cgctgtaagagggtcttcgagtacgacttcctccccgtcggggacatgctggacagcctg
ccgagggtcctggcactgatcgaatgcctgggcatgtacgactggtccctggccgtcaag
ttcttcctgcatgtgctgacttttggatcggccatttacagctctggttctgaacggcac
ctcaagtaccttccaaagatcttcagtttggagatttttggatgttttgctctgacggaa
gtgagtcatgggagtaacaccaagggtatacgcacgactgctcactacgaccccagcacc
caggaattcatcatccattcccccgattttgaagctgccaaattctgggttggcaacatg
ggcaagaccgctacccacgcagtggtgtttgctcagctgtacacgccggggggccagtgc
cacgggctgcacccctttctcgtccagattcgggacccgaagacccttcttcccatgccg
ggggtgatggtcggcgacattgggaagaagctggggcagaacggcctggacaacgggttc
gccatgttccacaaggtcaggattccccgccaggacctgctgaaccgctcaggagacgtc
acccctgagggcgcctacgtcacccacgtcaaggatgtggggcagcgcttcagcgagtcc
ctgggtagcctgtcgtctggccgggtcgccatcgtgggcatgtccgtcgtgaacctgaag
ctggccgtgtccattgctctgcgtttctcggccaccaggcgtcagtttgggccgacggac
aaggaggaagtcccggtgctgcagtacccgatgcagcaatggcgcttactgccgtacctg
gccgccgcctacgccttggaccactttttcaaatcgctcttcctggatctgggggagctt
cagcaaggcctcctggggaaagaccggagcgtcaggcaggccgagctgggacgcgagatc
cacgccttgtcgtctgccggcaagcccctggcctcgtggacggcccagcgggggatccag
gagtgccgcgaggcatgtggaggacacggctacctggccatgaaccgtctgggcgacctc
agagacgacaacgaccccaactgcacgtacgaaggcgacaacagcgtcctgctgcagcag
accagccgctacctgctcggcctgctggcccgccggggccccggtggtgcccgcatcgag
agccccctgaagaccgtggactttctggatggctatgcagacatccttggcaggaggttc
gagggctccagccccgaggacttgttggactcctcagtcccgctggcggcatacgagtgg
ctggtctgctacctgctccgtgagagccaccagaagctcagtcgagagaagcgctcaggg
aaaagcgactttgaagccataaacgactgtcaggtgtaccactgccggcccttggccctg
gcgttcctggagctcacggtcgtgcgcaggttccacgagcacacgcaccagccccgcgtg
ccacccccgctgcgggccgtgctccggcgtctcagcgccctctacgccctgtggtccctg
agccagcacaccgccctgctctaccgaggcggctacttctccggtgagcgtgcaggtaaa
gtgctggagagcgccatcctggccctgtgtgcacagctgaaagatgatgctgttgccctg
gtggatgtcatcgcccctccggacttcatcctggactcaccgattggcagagcagatggc
gagctctataaaaatctctggactgccgtccttcaggaaaataaggtgctggagcgggca
tcttggtgggcggaatttgcggtcaacaagcccgtcataggaagtttgaaaccaaagctg
taa

DBGET integrated database retrieval system