KEGG   Bos taurus (cow): 510434Help
Entry
510434            CDS       T01008                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
bta  Bos taurus (cow)
Pathway
bta01521  EGFR tyrosine kinase inhibitor resistance
bta01522  Endocrine resistance
bta04010  MAPK signaling pathway
bta04012  ErbB signaling pathway
bta04014  Ras signaling pathway
bta04015  Rap1 signaling pathway
bta04022  cGMP-PKG signaling pathway
bta04024  cAMP signaling pathway
bta04066  HIF-1 signaling pathway
bta04068  FoxO signaling pathway
bta04071  Sphingolipid signaling pathway
bta04072  Phospholipase D signaling pathway
bta04140  Autophagy - animal
bta04150  mTOR signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04210  Apoptosis
bta04218  Cellular senescence
bta04270  Vascular smooth muscle contraction
bta04370  VEGF signaling pathway
bta04371  Apelin signaling pathway
bta04540  Gap junction
bta04550  Signaling pathways regulating pluripotency of stem cells
bta04620  Toll-like receptor signaling pathway
bta04650  Natural killer cell mediated cytotoxicity
bta04660  T cell receptor signaling pathway
bta04662  B cell receptor signaling pathway
bta04664  Fc epsilon RI signaling pathway
bta04720  Long-term potentiation
bta04722  Neurotrophin signaling pathway
bta04730  Long-term depression
bta04810  Regulation of actin cytoskeleton
bta04910  Insulin signaling pathway
bta04912  GnRH signaling pathway
bta04915  Estrogen signaling pathway
bta04916  Melanogenesis
bta04917  Prolactin signaling pathway
bta04919  Thyroid hormone signaling pathway
bta04921  Oxytocin signaling pathway
bta04926  Relaxin signaling pathway
bta04934  Cushing's syndrome
bta05020  Prion diseases
bta05161  Hepatitis B
bta05164  Influenza A
bta05165  Human papillomavirus infection
bta05167  Kaposi's sarcoma-associated herpesvirus infection
bta05200  Pathways in cancer
bta05205  Proteoglycans in cancer
bta05206  MicroRNAs in cancer
bta05210  Colorectal cancer
bta05211  Renal cell carcinoma
bta05213  Endometrial cancer
bta05214  Glioma
bta05215  Prostate cancer
bta05216  Thyroid cancer
bta05218  Melanoma
bta05219  Bladder cancer
bta05220  Chronic myeloid leukemia
bta05221  Acute myeloid leukemia
bta05223  Non-small cell lung cancer
bta05224  Breast cancer
bta05225  Hepatocellular carcinoma
bta05226  Gastric cancer
bta05230  Central carbon metabolism in cancer
bta05231  Choline metabolism in cancer
Module
bta_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    510434 (MAP2K2)
   04015 Rap1 signaling pathway
    510434 (MAP2K2)
   04010 MAPK signaling pathway
    510434 (MAP2K2)
   04012 ErbB signaling pathway
    510434 (MAP2K2)
   04370 VEGF signaling pathway
    510434 (MAP2K2)
   04371 Apelin signaling pathway
    510434 (MAP2K2)
   04066 HIF-1 signaling pathway
    510434 (MAP2K2)
   04068 FoxO signaling pathway
    510434 (MAP2K2)
   04072 Phospholipase D signaling pathway
    510434 (MAP2K2)
   04071 Sphingolipid signaling pathway
    510434 (MAP2K2)
   04024 cAMP signaling pathway
    510434 (MAP2K2)
   04022 cGMP - PKG signaling pathway
    510434 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    510434 (MAP2K2)
   04150 mTOR signaling pathway
    510434 (MAP2K2)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    510434 (MAP2K2)
  Cell growth and death
   04210 Apoptosis
    510434 (MAP2K2)
   04218 Cellular senescence
    510434 (MAP2K2)
  Cellular community - eukaryotes
   04540 Gap junction
    510434 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    510434 (MAP2K2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    510434 (MAP2K2)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    510434 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    510434 (MAP2K2)
   04660 T cell receptor signaling pathway
    510434 (MAP2K2)
   04662 B cell receptor signaling pathway
    510434 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    510434 (MAP2K2)
  Endocrine system
   04910 Insulin signaling pathway
    510434 (MAP2K2)
   04912 GnRH signaling pathway
    510434 (MAP2K2)
   04915 Estrogen signaling pathway
    510434 (MAP2K2)
   04917 Prolactin signaling pathway
    510434 (MAP2K2)
   04921 Oxytocin signaling pathway
    510434 (MAP2K2)
   04926 Relaxin signaling pathway
    510434 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    510434 (MAP2K2)
   04916 Melanogenesis
    510434 (MAP2K2)
  Circulatory system
   04270 Vascular smooth muscle contraction
    510434 (MAP2K2)
  Nervous system
   04720 Long-term potentiation
    510434 (MAP2K2)
   04730 Long-term depression
    510434 (MAP2K2)
   04722 Neurotrophin signaling pathway
    510434 (MAP2K2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    510434 (MAP2K2)
   05230 Central carbon metabolism in cancer
    510434 (MAP2K2)
   05231 Choline metabolism in cancer
    510434 (MAP2K2)
   05206 MicroRNAs in cancer
    510434 (MAP2K2)
   05205 Proteoglycans in cancer
    510434 (MAP2K2)
   05210 Colorectal cancer
    510434 (MAP2K2)
   05225 Hepatocellular carcinoma
    510434 (MAP2K2)
   05226 Gastric cancer
    510434 (MAP2K2)
   05214 Glioma
    510434 (MAP2K2)
   05216 Thyroid cancer
    510434 (MAP2K2)
   05221 Acute myeloid leukemia
    510434 (MAP2K2)
   05220 Chronic myeloid leukemia
    510434 (MAP2K2)
   05218 Melanoma
    510434 (MAP2K2)
   05211 Renal cell carcinoma
    510434 (MAP2K2)
   05219 Bladder cancer
    510434 (MAP2K2)
   05215 Prostate cancer
    510434 (MAP2K2)
   05213 Endometrial cancer
    510434 (MAP2K2)
   05224 Breast cancer
    510434 (MAP2K2)
   05223 Non-small cell lung cancer
    510434 (MAP2K2)
  Neurodegenerative diseases
   05020 Prion diseases
    510434 (MAP2K2)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    510434 (MAP2K2)
  Infectious diseases
   05164 Influenza A
    510434 (MAP2K2)
   05161 Hepatitis B
    510434 (MAP2K2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    510434 (MAP2K2)
   05165 Human papillomavirus infection
    510434 (MAP2K2)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    510434 (MAP2K2)
   01522 Endocrine resistance
    510434 (MAP2K2)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     510434 (MAP2K2)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: STE group
  STE7 family
   510434 (MAP2K2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH Seadorna_VP7 Kdo
Motif
Other DBs
NCBI-GeneID: 510434
NCBI-ProteinID: NP_001033160
BGD-bta: BT25071
Ensembl: ENSBTAG00000024450
UniProt: Q17QH2
Position
7
AA seq 400 aa AA seqDB search
MLARRKPVLPALTINPAIAEGPSPTSEGASEAHLVDLQKKLEELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEAIFGRPMVDGAEGEPPSISPRPRP
PGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTQDFQEFVNKCLIKNPAERADL
KMLMNHTFIKRSEVEEVDFAGWLCKTLRLNQPSTPTRTAV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcaccatcaaccccgccatcgccgag
ggcccgtcccctaccagcgagggcgcctccgaagcacatctggtggacctccagaagaag
ctagaggagctagagctcgacgagcagcagaagaagcggctggaagccttccttacccag
aaggccaaggttggtgagctcaaggacgatgactttgaacggatctccgagctgggagcc
ggcaatggcggagtggtcaccaaggtccagcacagaccttcgggcctcatcatggccaga
aagctgatccacctggagatcaagccggccatccggaaccagatcatccgagagctacag
gtgctgcatgagtgcaactccccgtacattgtgggcttctacggggccttctacagcgac
ggcgagatcagcatctgcatggagcacatggatggcggctccctggaccaggtgttgaaa
gaagccaagagaatccctgaagagatcctgggcaaggtcagcattgcggttctgcggggc
ctggcatacctccgggagaaacaccagatcatgcaccgagacgtgaagccgtccaacatc
ctggtcaactcccggggggagatcaagctgtgtgacttcggggtgagcggccagctcatc
gactccatggccaactccttcgtggggacgcggtcctacatgtctccggagcggctacaa
ggcacacactactcggtgcagtcagacatctggagcatgggcctgtccctggtggaactg
tccatcggcaggtaccccatccccccgccggacgccaaggagctggaggccatattcggc
cggcccatggttgatggcgcagaaggagaacctcctagcatctctccacggccgaggccc
cctggacgccccatcagcggtcacgggatggacagccggcctgccatggcgatctttgag
ctgctggactacattgtgaacgagcctcctcccaagctgcccaacggtgtgttcacccag
gacttccaggagtttgtaaataaatgcctaattaagaacccagctgagcgagcagacctg
aagatgctcatgaaccacaccttcatcaagcggtccgaggtggaagaagtggattttgct
ggctggttgtgtaaaacactgcggctaaaccagcccagcacgcccacacgcaccgccgtg
tga

DBGET integrated database retrieval system