KEGG   Bos taurus (cow): 510547
Entry
510547            CDS       T01008                                 

Gene name
RPL4
Definition
(RefSeq) 60S ribosomal protein L4
  KO
K02930  large subunit ribosomal protein L4e
Organism
bta  Bos taurus (cow)
Pathway
bta03010  Ribosome
bta05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    510547 (RPL4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    510547 (RPL4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bta03011]
    510547 (RPL4)
Ribosome [BR:bta03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    510547 (RPL4)
  Archaea
    510547 (RPL4)
SSDB
Motif
Pfam: Ribosomal_L4 Ribos_L4_asso_C
Other DBs
NCBI-GeneID: 510547
NCBI-ProteinID: NP_001014894
BGD-bta: BT22462
Ensembl: ENSBTAG00000005211
UniProt: Q58DW0
Position
10
AA seq 422 aa
MACARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGH
QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRRWHRRVNTTQK
RYAICSALAASALPALVMSKGHRIEEVPELPLVVEDKVEGYKKTKEAVLLLKKLKAWNDI
KKVYASQRMRAGKGKMRNRRRIQRRGPCIIYNEDNGIIKAFRNIPGITLLNVSKLNILKL
APGGHVGRFCIWTESAFRKLDELYGTWRKAASLKSNYNLPMHKMLNTDLSRILKSPEIQR
ALRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKIRMDKAAAALEA
KSDQKGVQGKKPVVGNKEKKAVGDKKLKKPVVGKKAAGTKKPAAEKKPTEKKPTSEEKKA
AA
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggcgtgtgctcgtccactgatatcagtgtactccgaaaagggggagtcctctggcaaa
aatgtcactttgcctgctgtgttcaaggctcccattcgacccgatattgttaactttgtt
cacaccaacttgcgcaaaaacaacagacagccctatgctgtcagtgaattagcaggtcat
caaaccagtgctgagtcttggggtaccggcagagctgtggctcgaattcccagggttcga
ggtggcgggactcaccgttccggtcagggcgcttttggaaacatgtgtcgtgggggccgc
atgtttgcgccaactaagacctggcgacgttggcaccgcagagtgaatacgacgcagaag
cgatacgccatctgctctgcactggctgcctcagccttaccagcgctggtcatgtctaaa
ggtcatcgtatagaggaagttcctgaacttcctttggtggtggaagataaagttgaaggc
tacaagaagaccaaggaggctgtgttgcttctgaagaaacttaaggcctggaatgatatc
aaaaaggtctatgcctctcagcgaatgagagctggcaaaggcaagatgagaaaccgtcgc
cgtatccagcgcaggggaccctgcatcatctataatgaggacaatggtatcatcaaggcc
ttcagaaacatccctggaattactctgcttaatgtaagcaagctgaacattttgaaactt
gctcctggtggtcacgtgggacgtttctgcatttggactgaaagtgctttccgaaagtta
gatgagctatatggcacttggcgtaaagcagcctccctcaagagtaactacaacctccct
atgcacaagatgctcaatacagaccttagcagaatcttgaaaagcccagaaatccaaaga
gcactccgagcaccacgcaagaagattcatcgcagagtcctgaagaagaatccactgaaa
aacctgagaatcatgttgaagcttaatccatatgcaaagaccatgcgcaggaacaccatt
cttcgacaggccaggaatcacaaaatccgcatggataaggcagcagcagcactagaagcc
aaatcagatcagaaaggggttcagggcaagaagcctgtggtgggaaacaaggaaaagaag
gctgttggcgataagaagctgaagaagcctgtggtgggaaaaaaggctgcagggaccaag
aaaccagcagctgaaaagaagcccacagaaaagaaacccacctcagaggaaaagaaggct
gctgcgtaa

DBGET integrated database retrieval system