KEGG   Bos taurus (cow): 510841Help
Entry
510841            CDS       T01008                                 

Gene name
PDK3
Definition
(RefSeq) pyruvate dehydrogenase kinase 3
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     510841 (PDK3)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   510841 (PDK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 510841
NCBI-ProteinID: NP_001095404
BGD-bta: BT18648
Ensembl: ENSBTAG00000017832
VGNC: 32705
UniProt: A6QLG3
Position
X
AA seq 415 aa AA seqDB search
MRLFRLLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANT
MREVNLLPENLLNRPSVGLVQSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVRNRHN
DVVPTMAQGVIEYKEKFGFDPFISSNIQYFLDRFYTNRISFRMLINQHTLLFGGDTNPVH
PKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAKAPNKPIQVVYVPSH
LFHMLFELFKNSMRATVELYEDRKEGYPAVKTLVTLGKEDLSIKISDLGGGVPLRKIDRL
FNYMYSTAPRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKA
LSSESFERLPVFNKSAWRHYKSTAEADDWSNPSSEPRDASKYKAKQDKMKTNRTL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgttccggttgctgctgaagcagccggtgcccaagcagattgagcgctactcg
cgcttctcgccgtcgccgctctccatcaagcagttcctggacttcgggagagataatgcg
tgtgagaaaacttcgtatatgttcctacgaaaggagcttcctgtgcgcctggctaacaca
atgagagaagttaatcttctgccggagaacttgcttaaccgcccttcggtgggattggtt
cagagctggtatatgcagagttttcttgaacttctagaatatgaaaataagagccctgaa
gatccgcaggtcttggataactttctccaagtcctaattaaagtcagaaatagacacaat
gatgtggttcctacaatggcccaaggagtgatcgagtacaaggagaagtttgggtttgat
ccattcattagcagtaacatccagtattttctggaccgattttataccaaccgcatctct
ttccgcatgcttattaaccagcacacacttctgtttggcggtgacaccaatcctgtgcat
ccgaaacacatcggaagtattgatcccacctgcaacgttgctgatgttgtgaaagatgcg
tatgaaaccgccaagatgctttgtgaacagtattatctggtagctccagagctggaagtt
gaagaattcaatgccaaagctccaaacaaacctattcaggtagtttatgtgccctcacac
ctctttcacatgctctttgagttgttcaagaactcaatgagagcaacagttgaactatat
gaagatagaaaagagggctacccagctgttaaaaccctggttactctgggtaaagaagac
ttatccattaagataagtgacctaggtggtggggttccactccgaaaaatagatcgcctt
tttaactacatgtattcaactgctccgagacctagcctggagcctacccgagctgcccca
ttggctggatttggttatggcttgccaatttctcgtctgtatgctagatattttcaagga
gatctaaagctctattctatggaaggcgtgggtactgatgctgtcatttatttaaaggcc
ctttcaagtgaatcatttgagagacttccggtttttaacaagtccgcatggcgccattac
aagagcacagctgaagctgacgattggagcaatcccagcagtgagcccagggacgcttcc
aaatacaaggcaaaacaggacaagatgaagactaacagaactttgtaa

DBGET integrated database retrieval system