KEGG   Bos taurus (cow): 510953Help
Entry
510953            CDS       T01008                                 

Gene name
PON3
Definition
(RefSeq) serum paraoxonase/lactonase 3 precursor
  KO
K01045  arylesterase / paraoxonase [EC:3.1.1.2 3.1.8.1]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    510953 (PON3)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.2  arylesterase
     510953 (PON3)
   3.1.8  Phosphoric-triester hydrolases
    3.1.8.1  aryldialkylphosphatase
     510953 (PON3)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   510953 (PON3)
  Exosomal proteins of other cancer cells
   510953 (PON3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arylesterase SGL Str_synth
Motif
Other DBs
NCBI-GeneID: 510953
NCBI-ProteinID: NP_001068947
BGD-bta: BT12148
Ensembl: ENSBTAG00000034645
VGNC: 33162
UniProt: Q1JQD3
Position
4
AA seq 354 aa AA seqDB search
MGKLMALILLGAGLALVGERFLTLRERMNAYREVESVESQNCHLIEGIENGSEDIDILPS
GLAFISNGLKYPGMPDLAPDEPGRIFLMDLNEQNPRVQELNISDGFDKASFNPHGMSTFI
DKDQTVYLYVVNHPHMDSTVEIFKFEEQQRSLVYLKTIKHELLKSVNDIVVLGPEQFYAT
RDHYFTNFFLVLLELFMDLRWTQVLFYSPKEVKVVARGFSSANGITISLDKKYIYVADVS
DKNIHVMKIHDNWDLTQLKVIQLDTLVDNLTVDPDTGDILAGCHPNAIKLLMYNTEDPPG
SEALRIRNALSEKPMISTMYANNGSVLQGSSVASVYRGKLLIGTVFHKALYCEL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggggaagctgatggcacttatcctgctgggcgccggcctggccctagtcggggagaga
tttttgacacttcgagaaagaatgaatgcatatcgagaagtggagtcagtagaatcccag
aactgccaccttattgagggaattgaaaatggctctgaagatattgatatccttcctagt
gggctggctttcatctccaatggattaaaatatccaggcatgccagaccttgcaccagat
gagccaggacgaatcttcttgatggatttaaatgagcaaaaccctagggtccaggaatta
aacatcagtgatggttttgacaaagcatcctttaatccacatggaatgagtactttcatt
gacaaagaccaaactgtatatctttatgttgtgaatcatccccacatggactccaccgtg
gagatatttaaatttgaagaacaacaacgttctttggtatacctgaaaactataaaacac
gaacttctcaaaagtgtgaatgatattgtggttctcggaccagaacagttctatgccacc
agagaccactattttaccaacttcttcttggtgctattagagttgttcatggatcttcgc
tggactcaggtgctcttctacagcccaaaagaggttaaagtggtggccagaggatttagt
tctgccaatggaattacaatctcactagacaagaagtatatctatgtagctgatgtatca
gataagaacattcatgttatgaaaatacatgacaactgggatttaactcaactcaaggta
atccagttggacaccttagtggataacttaactgttgatcctgacacgggagatattttg
gcaggatgccatcctaatgctatcaagctgctgatgtataacaccgaggatcctccaggg
tcagaagcacttcgcatccggaacgctttgtctgagaagcccatgataagcaccatgtat
gccaacaatggctcggtgcttcagggcagctctgtggcttctgtgtatagggggaagctt
ctcataggcactgtatttcacaaagccctgtactgtgagctctag

DBGET integrated database retrieval system