KEGG   Bos taurus (cow): 511110Help
Entry
511110            CDS       T01008                                 

Gene name
STMN3
Definition
(RefSeq) stathmin-3
Organism
bta  Bos taurus (cow)
SSDB OrthologParalogGFIT
Motif
Pfam: Stathmin HrpF Exonuc_VII_L
Motif
Other DBs
NCBI-GeneID: 511110
NCBI-ProteinID: NP_001077135
BGD-bta: BT13456
Ensembl: ENSBTAG00000038974
VGNC: 35405
UniProt: A4IFK9
Position
13
AA seq 180 aa AA seqDB search
MASTISAYKEKMKELSVLSLICSCFYSQPHPNTVYQYGDMEVKQLDKRASGQSFEVILKS
PSDLSPESPMLSSPPKRKDTSLEELQKRLEAAEERRKTQEAQVLKQLAERREHEREVLHK
ALEENNNFSRLAEEKLNYKMELSKEIREAHLAALRERLREKELHAAEVRRNKEQREEMSG
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaccatctccgcatacaaggagaagatgaaggaactgtcggtgctgtcgctc
atctgctcctgcttctactcacagccgcaccccaacaccgtctaccagtatggggacatg
gaggtgaaacagctggacaagagggcctccggccagagctttgaggtcatcctcaagtcc
ccttccgacctgtccccggagagtcccatgctctcctccccccccaagaggaaggacacc
tccctggaagagctgcagaagcggctggaggcagctgaggagcggaggaagacgcaggag
gcgcaggtgctgaagcagctggcggagcggcgcgagcacgaacgcgaggtgttgcacaag
gcgctggaggagaacaacaacttcagccgtctggccgaggagaagctcaactacaagatg
gagctcagcaaggagattcgcgaggcgcacctggcggcgctgcgtgagcggctgcgcgag
aaggagctgcacgcggccgaggtgcgcaggaacaaggagcagcgcgaggagatgtccggc
taa

DBGET integrated database retrieval system