KEGG   Bos taurus (cow): 511224
Entry
511224            CDS       T01008                                 

Gene name
NFATC1
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 1
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04022  cGMP-PKG signaling pathway
bta04024  cAMP signaling pathway
bta04218  Cellular senescence
bta04310  Wnt signaling pathway
bta04380  Osteoclast differentiation
bta04625  C-type lectin receptor signaling pathway
bta04650  Natural killer cell mediated cytotoxicity
bta04658  Th1 and Th2 cell differentiation
bta04659  Th17 cell differentiation
bta04660  T cell receptor signaling pathway
bta04662  B cell receptor signaling pathway
bta04921  Oxytocin signaling pathway
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta05135  Yersinia infection
bta05161  Hepatitis B
bta05163  Human cytomegalovirus infection
bta05166  Human T-cell leukemia virus 1 infection
bta05167  Kaposi sarcoma-associated herpesvirus infection
bta05170  Human immunodeficiency virus 1 infection
bta05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bta05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    511224 (NFATC1)
   04310 Wnt signaling pathway
    511224 (NFATC1)
   04024 cAMP signaling pathway
    511224 (NFATC1)
   04022 cGMP-PKG signaling pathway
    511224 (NFATC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    511224 (NFATC1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    511224 (NFATC1)
   04650 Natural killer cell mediated cytotoxicity
    511224 (NFATC1)
   04660 T cell receptor signaling pathway
    511224 (NFATC1)
   04658 Th1 and Th2 cell differentiation
    511224 (NFATC1)
   04659 Th17 cell differentiation
    511224 (NFATC1)
   04662 B cell receptor signaling pathway
    511224 (NFATC1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    511224 (NFATC1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    511224 (NFATC1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    511224 (NFATC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    511224 (NFATC1)
   05170 Human immunodeficiency virus 1 infection
    511224 (NFATC1)
   05161 Hepatitis B
    511224 (NFATC1)
   05163 Human cytomegalovirus infection
    511224 (NFATC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    511224 (NFATC1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    511224 (NFATC1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    511224 (NFATC1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    511224 (NFATC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bta03000]
    511224 (NFATC1)
Transcription factors [BR:bta03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    511224 (NFATC1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 511224
NCBI-ProteinID: NP_001160087
BGD-bta: BT20788
Ensembl: ENSBTAG00000000656
VGNC: 32030
UniProt: A0A3Q1LGN8
Position
24
AA seq 914 aa
MTGLEEDQEFDFDFLFEFNQSDEGAVAAPAEHYGYAAPGLGAGLPLSAAHPSLPAPCHDL
QSSAAGVSAVGYGGTVDSGPSGYFLSSGGIRPNGAPALESPRIEITSYLGLHHNSSQFLH
EVDVEDVLPKRSPSTATLNLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESSFSYPYAS
PQTSPWQSPCVSPKTTDPEEGFARGLGACGLLGSPRHSPSTSPRTSVTEESWLGARTSRP
SSPCNKRKYGLNGRQLSCSPHPSPTPSPQGSPRVSVTDDTWLGNTTQYTSSAIVAAINAL
STDSSLDLGDGVPVKARKTTLDHSPAVALKVEPAGEDLGTTPPTPDFQPEEFAAFQHIRK
GAFCDQYLSVPQHPYPWARPRSPASYTSPSLPALDWQLPSHSGPYELRIEVQPKSHHRAH
YETEGSRGAVKASAGGHPSVQLHGYVESEPLTLQLFIGTADDRLLRPHAFYQVHRITGKT
VSTASHEAVVCSTKVLEIPLLPENNMRATIDCAGILKLRNSDIELRKGETDIGRKNTRVR
LVFRVHIPQPNGRTLSLQVASNPIECSQRSAQELPLVEKQSAASGPVLGGKRMVLSGHNF
LQDSKVIFVEKAPDGHHIWEMEAKTEGDLCKPNSLVVEIPPFRNQRITSPVQVNFYVCNG
KRKRSQYQHFTYLPANVPIIKTEPSDDYEPALTCGPMSQGLSPLPKPCYGQPLALPPDPG
ACLMPGFPPRPQGSASPELHDLSCAPYGSATAGPGHSPLGLPRPVGGVLASQEAPRPSGV
PPGPPQPPPPTLLQPQVSPTSSGSCSPGRRPALCPHSPSSPLPPGTRELTRLQPCGPAHP
CGTGHQQHQPPEVPSSEPAAARPPPPPEVREDSNRSLAPIPVTVKREPQELDPLDLDDVN
EIIRNDLSSTHIHS
NT seq 2745 nt   +upstreamnt  +downstreamnt
atgacggggctggaggaggaccaggagttcgactttgacttcctcttcgagtttaaccag
agcgacgagggcgccgtcgcggcccccgcagagcactatggctacgccgcccccggcctg
ggtgcgggcctgcccctctctgcggctcacccctcgctgcctgctccatgccacgacctg
cagagctcggccgcgggcgtctccgccgtgggctatggcgggacagtggacagcgggccc
tcaggctacttcctgtcatccggcggcatccggcccaacggggcaccggccctggagagc
ccgcgcatcgagatcacctcctaccttgggctgcaccacaacagcagccagttcctgcat
gaggtggacgtggaggacgtcctccccaagcggtccccatccacggccacgctgaacctg
cccagcctggaggcctaccgtgacccctcctgcctgagccccgccagcagcctgtcctcc
cgaagctgcaactctgaggcctcgtcctacgagtccagcttctcgtacccatacgcgtct
ccgcagacgtccccctggcagtccccctgcgtgtcccccaagaccacagaccccgaggag
ggcttcgcccgtggcctgggggcctgcggcctgctcgggtccccacggcactcgccctcc
acctccccccgcaccagcgtcaccgaggagagctggctgggggcccgcacgtccaggccc
tcgtccccgtgcaacaagcgcaagtacgggctcaacggccggcagctgtcctgctccccg
cacccctcgcccacgccgtccccgcagggctcgccgcgggtcagcgtcaccgacgacacc
tggctgggcaacaccacacagtacaccagctcggccatcgtggccgccatcaacgccctg
agcaccgacagcagcctggacctgggtgacggcgtcccggtcaaggcccgcaagaccacg
ctggaccactcgcccgcggtggcgctcaaggtggagccggcgggcgaggacctggggacc
acgccgcccacgcctgacttccagcccgaggagttcgcggccttccagcacatccgcaag
ggcgctttctgcgaccagtacctgtcggtgccgcagcacccgtacccgtgggcccggccg
cggtcccccgcgtcctacaccagcccgtccctgccggctcttgactggcagctgccgtca
cactcaggaccctacgagctgaggatcgaggtgcagcccaagtcccaccaccgtgcccac
tacgagacggagggcagccgcggggccgtgaaggcatcagccgggggccaccccagcgtg
cagctgcatggctatgtggagagcgagcctctgaccctgcagctcttcatcggcacggcg
gacgaccggctgctgaggccacacgccttctatcaggtgcaccggatcacgggcaagacc
gtgtccaccgccagccacgaggccgtcgtctgcagcaccaaggtcctggagatcccgctg
ctgccggagaacaacatgcgcgccaccatcgactgtgccgggatcctgaagctcaggaac
tccgacatcgagctgcgcaagggggagacggacatcgggagaaagaacacgcgggtgcgg
ctggtcttccgcgtccacatcccgcagcccaacggccggacgctgtcactgcaggtggcc
tccaaccccatcgaatgctcccagcgctcggcccaggagctgcccctggtggagaagcag
agtgcggccagcggccccgtcctcggagggaagaggatggtcctctccggccacaacttt
ctgcaggactccaaggtcatttttgtggagaaagcaccagatgggcaccacatctgggag
atggaggcaaaaactgaaggagacctgtgtaagccgaactcgctggtggtggagatcccg
cctttccgcaaccagaggataaccagccctgtgcaggtcaacttctacgtctgcaacggg
aagaggaagcggagccagtaccagcacttcacctacctgcctgccaacgttccaatcata
aaaacggagcccagcgatgattacgagcctgccctcacctgtggaccaatgagccagggc
ctgagcccgctccccaagccttgctacggccagccgctcgccctgccgcccgacccggga
gcctgcctcatgcctggcttcccaccccgtccacagggcagtgccagccctgagctccac
gacctttcctgcgccccttacggctcggccacggccggcccgggccacagccccctcgga
cttccgcggccagtcggtggggtcctcgccagccaggaggcgccgagaccctcgggtgtg
cctcccgggcccccccagccaccgccccccactctgctgcagccacaggtgagtccgacg
tcaagcggtagctgctccccggggcgccggccagcgctctgtccccacagcccctcctct
ccgctgccgcctgggacccgagagctgacccgcctgcagccctgtggcccagcgcacccc
tgcgggacgggccaccagcagcaccagccacctgaggttccgagcagcgagcccgccgcc
gcccggcccccgccgccgcccgaggtgcgtgaggacagtaatcgtagtctggcccccatt
cccgtaacggtcaagcgagagcctcaggagctggacccactcgacctggatgacgtaaat
gagataatccggaatgacctctccagcacccacatccactcgtag

DBGET integrated database retrieval system