KEGG   Bos taurus (cow): 511331
Entry
511331            CDS       T01008                                 

Gene name
TXLNA
Definition
(RefSeq) alpha-taxilin
Organism
bta  Bos taurus (cow)
SSDB
Motif
Pfam: Taxilin FlaC_arch
Other DBs
NCBI-GeneID: 511331
NCBI-ProteinID: XP_002685114
Ensembl: ENSBTAG00000012867
VGNC: 36530
UniProt: E1BGS4
Position
1
AA seq 561 aa
MKNQDKKNGPSKQSGNTSNPKNTPGQPEAGPEGAQGRPSQSAPATEAEGSTSQAAGKAEG
AQAKSAQSGALRDVSEELSRQLEDILSTYCVDNSQGGPGEDVAQGEPAEPEDAEKSRTYA
SRNGEPEPETPVVNGEKEISKGEPGPDEIRTSDEVVDRDHRRPQEKKKAKGLGKEITLLM
QTLNTLSTPEEKLAALCKKYAELLEEHRNSQKQMKLLQKKQSQLVQEKDHLRGEHSKAVL
ARSKLESLCRELQRHNRSLKEEGVQRAREEEEKRKEVTSHFQVTLNDIQLQMEQHNERNS
KLRQENVELAERLKKLIEQYELREEHIDKVFKHKDLQQQLVDAKLQQAQEMLKEAEERHQ
REKDFLLKEAVESQRMCELMKQQETHLKQQLALYTEKFEEFQNTLSKSSEVFTTFKQEME
KMTKKIKKLEKETTMYRSRWESSNKALLEMAEEKTLRDKELEGLQVKIQRLEKLCRALQS
ERNDLNKRVQDLSAGSQAPLTDSGPERRAEAANASKEQGSEGPRVQTPSSPRATEAPCCP
GALSTDPSGQTGPQEPTSITA
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgaagaaccaagacaaaaagaatgggccttccaagcaatcaggcaacacttccaacccc
aaaaacactccggggcaaccggaagcaggacctgagggagcccaggggcggcccagccag
tcggctcctgcgacagaagctgaaggttccaccagccaggctgcagggaaggcagaggga
gcacaagccaagagtgctcagtctggagccctccgtgatgtctctgaggagttgagccgc
cagctggaagacatcctcagtacatactgcgtggacaacagtcaagggggcccaggtgag
gatgtggcacagggtgagcctgctgaacccgaagatgcagagaagtcccggacctatgcc
tcaaggaatggggagcctgagccagagactccagtagtcaatggtgagaaggaaatctcc
aagggggagccgggcccggacgagatccggaccagtgatgaagtcgtagaccgagaccac
cgaaggccacaggagaagaagaaagccaagggtctgggaaaggagatcacattactaatg
cagacgctgaacacgctgagtacccctgaggagaagctcgcagctctgtgcaagaagtat
gctgagctgctggaagagcaccggaactcccagaagcagatgaagctcttgcagaagaag
cagagccagctggtgcaggagaaggaccacctgcgcggcgagcacagcaaggctgtcctg
gcccgcagcaagctcgagagcctctgccgtgagctgcagcgccataaccgctccctcaag
gaagaaggtgtgcagcgggcccgggaggaggaggagaaacgcaaggaagtgacctcgcac
ttccaggtgacgctgaatgacatccagctgcagatggaacagcacaatgagcgcaattcc
aagctacgccaggagaacgtggagctggctgaaaggctcaagaagctgattgagcagtat
gagctgcgggaggagcacattgacaaagtcttcaaacacaaggacctgcagcagcagctg
gtggacgccaagctccagcaggcccaggagatgctgaaggaggcagaggagaggcaccag
cgggagaaggattttctcctcaaagaggctgtggagtcccagaggatgtgcgagctgatg
aagcagcaggagacccacctgaaacagcagcttgccctgtacactgagaagtttgaggag
ttccagaacactctttccaaaagtagtgaggtgttcaccacattcaaacaggagatggaa
aagatgactaagaagatcaagaagctggaaaaggaaaccaccatgtaccggtcccggtgg
gagagcagcaacaaggccctgcttgagatggccgaggagaaaacactccgggacaaagag
ctggagggcctgcaggtgaaaatccagcggctggagaagctgtgccgagcactgcagtca
gagcgcaatgacctgaacaagagggtgcaggacctgagtgctggcagccaggctcccctc
actgacagtggccctgagcgaagggcagaggctgccaacgcctctaaggagcagggcagc
gaggggcctagggttcaaacaccgagctccccaagagccacagaagctccttgctgcccc
ggagcactgagcacagacccttcaggccaaacggggccccaggaacccacctccatcacc
gcctag

DBGET integrated database retrieval system