KEGG   Bos taurus (cow): 511422
Entry
511422            CDS       T01008                                 

Gene name
COL6A1
Definition
(RefSeq) collagen alpha-1(VI) chain precursor
  KO
K06238  collagen type VI alpha
Organism
bta  Bos taurus (cow)
Pathway
bta04151  PI3K-Akt signaling pathway
bta04510  Focal adhesion
bta04512  ECM-receptor interaction
bta04974  Protein digestion and absorption
bta05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    511422 (COL6A1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    511422 (COL6A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    511422 (COL6A1)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    511422 (COL6A1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    511422 (COL6A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    511422 (COL6A1)
   00536 Glycosaminoglycan binding proteins [BR:bta00536]
    511422 (COL6A1)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   511422 (COL6A1)
Glycosaminoglycan binding proteins [BR:bta00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   511422 (COL6A1)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   511422 (COL6A1)
Motif
Pfam: VWA Collagen VWA_2 VWA_3 VWA_CoxE
Other DBs
NCBI-GeneID: 511422
NCBI-ProteinID: NP_001137337
BGD-bta: BT10745
Ensembl: ENSBTAG00000011802
VGNC: 27570
UniProt: E1BI98
Position
1
AA seq 1027 aa
MRLPRALLPLLLQACWASAQDDPVASRAIAFQDCPVDLFFVLDTSESVALRLKPYGALVD
KVKSFTKRFIDNLNDRYYRCDRNLVWNAGALHYSDEVEIIRGLTRMPSGRDELKSSVDAV
KYFGKGTYTDCAIKKGLEELLVGGSHLKENKYLVVVTDGHPLEGYKEPCGGLEDAVNEAK
HLGIKVFSVAITPDHLEPRLSIIATDHTYRRNFTAADWGQSRDAEEVISQTIDTITDMIK
NNVEQVCCSFECQPARGPPGPRGDPGYEGERGKPGLPGEKGEAGDPGRPGDLGPVGYQGM
KGEKGSRGEKGSRGPKGYKGEKGKRGMDGVDGMKGETGFPGLPGCKGSPGFDGIQGPPGP
KGDPGAFGLKGQKGEPGADGEPGRPGSTGPPGDEGEPGEPGPPGEKGEAGDEGNAGPDGA
PGERGGPGERGPRGTPGARGPRGDPGEAGPQGDQGREGPVGVPGDPGEAGPIGPKGYRGD
EGPPGTEGPKGAPGPAGPPGDPGLMGERGEDGPPGNGTEGFPGFPGYPGSRGPPGINGTK
GYPGLKGDEGEAGDPGEDNNDIAARGAKGAKGYRGPEGPQGPPGHVGPPGPDECEILDII
MKMCSCCECKCGPIDILFVLDSSESIGLQNFEIAKDFIVKVIDRLSKDELVKFEPGQSHA
GVVQYSHNQMQEHVDLRDPNIRNAQDLKEAIKKLQWMGGGTFTGEALQYTRSRLLPPTPN
NRIALVITDGRSDTQRDTTPLSVLCGPDIQVVSVGIKDVFGLAAGSDQLNVISCQGLAPQ
GRPGISLVKENYAELLDDGFLKNITAQICIDKKCPDYSCPITFSSPADITILLDGSASVG
SHNFDITKRFAKRLAERFLTASRTDPGQDVRVAVVQYSGTGQQRPERAALQFLQNYTVLA
NTVDSMDFFNDATDVMDALGYVTRFYREASSNAAKKRLLLFSDGNSQGATPAAIEKAVQE
AQRAGVEIFAVVVGRQVNEPHVRVLVTGKAAEYDVVFGERHLFRVPSYQALLRGVFYQTV
SRKVALD
NT seq 3084 nt   +upstreamnt  +downstreamnt
atgaggctgccccgcgctctgctccccctgctgctgcaggcctgctgggcctccgcgcag
gacgaccccgtggcctcaagggccatcgccttccaagactgccctgtggacctgttcttt
gtgctggacacctccgagagcgtggccttgaggctgaagccctatggggccctggtggac
aaggtcaagtccttcaccaagcgcttcattgacaacctgaacgacaggtactaccgctgt
gaccgcaacctggtgtggaatgcgggcgcgctgcactatagcgacgaagtggagatcatc
cgcgggctcacgcgcatgcccagcggccgcgacgagcttaagagcagcgtggacgccgtc
aagtacttcggaaagggcacctataccgactgcgccatcaagaagggtctggaggagctg
ctcgtggggggctcccacctaaaggagaacaagtacttggttgtggtgactgacgggcac
cccctggagggctacaaggagccctgcgggggcctggaggatgctgtgaacgaggccaag
catctgggcatcaaagtcttctccgtggccatcacgcccgaccacctggagccacgtctg
agcatcatcgccacggaccacacgtaccggcgcaacttcacggcggctgactgggggcag
agccgcgacgccgaggaagtcatcagccagaccatcgacaccatcaccgacatgatcaaa
aataatgtggagcaagtgtgctgctccttcgagtgccagcctgccagaggaccccccggg
cctcgaggcgaccccgggtacgagggagaaagagggaagccggggctcccgggagagaaa
ggagaagctggagaccctggaagacctggggaccttggacccgtcggctaccagggcatg
aagggagaaaaagggagccgaggggagaagggctccaggggacccaaaggctacaagggc
gagaagggaaagcgtggcatggacggcgtggatggcatgaagggggagacagggttccct
ggcctgccaggctgcaagggctcgcccggattcgatggtatccaaggaccccccgggccc
aagggtgacccaggtgccttcggactgaaaggacagaagggtgagcccggagcagacggg
gagcctgggaggcccgggagcacggggccgcctggagatgagggtgagcctggagagccc
ggtcccccgggagagaagggagaagccggcgatgagggaaatgcaggaccagacggagcc
cccggagagaggggcggccctggggaaagaggacctcgagggaccccaggtgcacggggc
cctagaggagacccgggtgaagctggaccccaaggtgaccagggacgagaaggccccgtc
ggtgtccccggtgacccgggcgaggctggccccattgggccgaaaggataccgaggtgat
gagggaccccctgggaccgagggccccaaaggagctccggggcctgcaggcccccccgga
gaccccgggctgatgggtgagaggggtgaagacggcccccccgggaatggcactgaaggc
ttccccggctttcccggctatccaggcagcagaggtcctcctgggataaacggcaccaaa
ggctaccctggcctcaagggggacgagggagaagccggggaccccggagaggacaataat
gacattgctgcacgaggcgccaaaggagcaaagggctaccgaggtcctgaaggcccccag
ggacccccaggacacgtgggaccaccggggccagacgaatgcgagattttggacatcatc
atgaaaatgtgctcttgctgtgagtgcaagtgcgggcccatcgacatcctcttcgtgctg
gacagctctgagagcatcggcctacagaacttcgagatcgccaaggacttcatcgtcaag
gtcattgaccggctgagcaaggatgagctggtcaagtttgagcctgggcagtcgcatgca
ggcgtggtgcagtacagccacaaccagatgcaggagcacgtggacctgagggaccccaac
atcaggaatgcccaggacctcaaggaggccatcaagaagctgcagtggatgggcggcggc
accttcacgggcgaggccctgcagtacacccggagccggctgctgccacccactccgaac
aaccgcattgccctggtcatcaccgatggccgctcagacacccagagggacaccacccca
ctcagcgtgctctgcggccctgacatccaggtggtctctgtgggcatcaaggatgtcttt
ggcttggctgcgggctccgaccagctcaacgtcatctcctgccaaggcctggcaccccag
ggacggccgggcatctcattggtcaaggaaaactacgccgagcttctggacgatggcttc
ctgaagaacatcactgcccagatctgcatagacaagaaatgtccagattacagctgccca
atcaccttctcctccccggccgacatcaccatcctcctggacggctccgccagcgtgggc
agccacaactttgacatcaccaaacgctttgccaagcggctggcagagcgcttcctgaca
gcgagccggacagacccgggccaggacgtgcgtgtggcagtggtgcagtacagcggtacg
gggcagcagcggccggagcgcgcggccctgcagttcctgcagaactacaccgtgctggcc
aacaccgtggactccatggacttcttcaatgacgccaccgacgtcatggacgccctgggc
tacgtgacccgcttctaccgcgaggcctcgtccaacgccgccaagaagaggctgctgctc
ttctcggatggcaactcgcaaggtgccacgccggccgccatcgagaaggcggtgcaggag
gcccagcgggcgggcgtggagatcttcgcggtggtggtgggccgccaggtgaacgagccc
cacgtgcgtgtcctggtcactggcaaggcggctgagtatgacgtggtcttcggcgagcgc
cacctgttccgcgtgcccagttaccaggcgttgctgcggggcgtcttctaccagacggtg
tccaggaaggtggcgctggactag

DBGET integrated database retrieval system