KEGG   Bos taurus (cow): 511575Help
Entry
511575            CDS       T01008                                 

Gene name
GPX8
Definition
(RefSeq) probable glutathione peroxidase 8
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bta  Bos taurus (cow)
Pathway
bta00480  Glutathione metabolism
bta00590  Arachidonic acid metabolism
bta04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    511575 (GPX8)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    511575 (GPX8)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    511575 (GPX8)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     511575 (GPX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA SCO1-SenC Redoxin
Motif
Other DBs
NCBI-GeneID: 511575
NCBI-ProteinID: NP_001039553
BGD-bta: BT15195
Ensembl: ENSBTAG00000021960
UniProt: Q2NL01
Position
20
AA seq 209 aa AA seqDB search
MEPLTAYPLRCSGPKAKAFAVLLSMVLCTVMLFLLQLKFLKPKINSFYTFEVKDANGRVV
SLEKFKGKVALVVNVASDCQLTDRNYLALQELHKEFGPFHFSVLAFPCNQFGESEPRPSK
EVVSFARNNFGVTFPIFHKIKILGSEAEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKT
WRPEEPIEVIRPEIAALIRQMIIKKKEDL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggagcctctcacagcctaccctttgagatgttcagggcccaaagcaaaggcatttgca
gtcttgctgtctatggttctgtgcacagtaatgctattcctcctacaactcaaattccta
aagcctaaaatcaacagcttttatacctttgaagtgaaagatgcaaatggaagggtggtt
tctctggaaaagtttaaaggcaaagttgcactagttgtaaacgtggctagtgactgccaa
ctcacagacagaaattacttagcactgcaggaactgcacaaagagtttggaccattccac
ttcagcgtcttggcttttccatgcaatcagtttggagaatcggagccccgcccgagcaag
gaagtagtatcttttgcaagaaataacttcggagtaacattccccatcttccacaagatt
aagattctaggatccgaagcagaacctgcatttagatttcttgttgattcttcaaagaag
gaaccaaggtggaacttttggaagtatctggtcaaccctgaaggtcaagttgtgaagacc
tggaggccagaggaacccattgaagtcatcaggcctgagatagcagctctgattagacaa
atgattataaaaaagaaagaggatctatga

DBGET integrated database retrieval system