KEGG   Bos taurus (cow): 511674Help
Entry
511674            CDS       T01008                                 

Gene name
CXCL13
Definition
(RefSeq) C-X-C motif chemokine 13 precursor
  KO
K10032  C-X-C motif chemokine 13
Organism
bta  Bos taurus (cow)
Pathway
bta04060  Cytokine-cytokine receptor interaction
bta04061  Viral protein interaction with cytokine and cytokine receptor
bta04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    511674 (CXCL13)
   04061 Viral protein interaction with cytokine and cytokine receptor
    511674 (CXCL13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    511674 (CXCL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bta04052]
    511674 (CXCL13)
Cytokines and growth factors [BR:bta04052]
 Cytokines
  Chemokines
   511674 (CXCL13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 511674
NCBI-ProteinID: NP_001015576
BGD-bta: BT10860
Ensembl: ENSBTAG00000008479
VGNC: 27849
UniProt: Q56JW7
Position
6
AA seq 109 aa AA seqDB search
MRFTPGALILMLLAFSLSPVHGVLETNNTNLKCKCIRKTVSFFPVNLIERLNIIPRGRGC
PNTEIIVWMKNKLVICLNPQAKWTQTLIKVLSKRILSTSPAPVVKKRSD
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgaggttcacccctggagctctgattcttatgctgctggccttcagcctctctcctgtc
catggtgttctggagaccaataacacaaacttaaagtgtaaatgcattcgaaagactgtc
agctttttccccgttaatctcattgaaagacttaatatcatcccccgtgggcgtggatgt
ccaaacacagaaatcatagtctggatgaagaataagctagttatctgcttgaaccctcaa
gccaaatggacacaaacactaatcaaagtgttaagcaaacgtattttgtcaacttcacca
gctccagtggttaagaaaaggagtgactga

DBGET integrated database retrieval system