KEGG   Bos taurus (cow): 512171Help
Entry
512171            CDS       T01008                                 

Gene name
ADAMTS1
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 1
  KO
K08617  a disintegrin and metalloproteinase with thrombospondin motifs 1 [EC:3.4.24.-]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bta01002]
    512171 (ADAMTS1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     512171 (ADAMTS1)
Peptidases and inhibitors [BR:bta01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   512171 (ADAMTS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADAM_spacer1 Pep_M12B_propep ADAM_CR_2 Reprolysin TSP_1 Reprolysin_5 Reprolysin_3 Reprolysin_2 Reprolysin_4 CxC6
Motif
Other DBs
NCBI-GeneID: 512171
NCBI-ProteinID: NP_001094550
BGD-bta: BT21164
Ensembl: ENSBTAG00000000706
VGNC: 25614
UniProt: A7MB07
Position
1
AA seq 970 aa AA seqDB search
MQRAVPAGFRKRTAGGDMGHKAPRARGLQPVPSPLLLLAAAAALLVVPGAHGRPAEEDEE
LVLPALERDPGLRTAHLRLDAFGRQLSLELHLDRGFLAPGFTLQTVGRRPEPDVQRSDPV
GDLAHCFYSGTVNGDPSSAAALSLCDGVRGAFYLQGEEYFIQPAPAAATLSLAPAAAAAA
AAAGEQQQARPQFHLLRRRRRGDGGAKCGVLDDETQLAGGAGPEGEDATVQWAPRDPAPQ
RPGHRTGTGSLRKKRFVSSPRYVETMLVADQSMAEFHGSDLKHYLLTLFSVAARLYKHPS
IRNSVSLVVVKILVIYEEKKGPEVTSNAALTLRNFCSWQKQHNPPSDRDAEHYDTAILFT
RQDLCGTQTCDTLGMADVGTICDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQC
AGINGLNRDSHMMASMLTNLDHNQPWSPCSASSITTFLDNGHGECLMDEPQLVIQLPSDL
PGTLYDASRQCQLTFGEESRHCPDAASTCMILWCTGTSGGLPVCQTKHFPWADGTSCGEG
KWCVNGQCLDQTDKEHFDTPVHGSWGPWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKY
CEGKRVRYRSCNIEDCPENNGKTFRMEQCEAHNEFSKASFGSGPAVEWIPKYAGVSPKDR
CKLICQAKGTGYFFVLQPKVVDGTPCSPDSTSVCVQGQCVKAGCDHIIDSKNKFDKCGIC
GGNGSTCKKVSGSVTTAKPGYHDIVTIPTGATNIEVKQRNHRGSRNNGSFLAIKAADGTY
ILNGDFTLSTLEQDITHKGSVLRYSGSSAALERIRSFSPLKEPLTIQVLTVGNAFRPKIK
YTYFVKKKKESFNAIPTFSEWVIEEWGECSKSCGLGVQRRLVECRDINGQPASECAKEVK
PASTRPCADLPCPRWQLGDWSPCSKTCGKGYKKRTLQCLSHDGGVLSHESCDPLKKPKHY
IDFCTVAECS
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcgcggttcccgcggggttccgaaagcgcacggcaggaggcgacatggggcac
aaggcgccgagggctcggggcttgcagcctgttccctcaccgctgctgctcctcgccgcg
gccgccgcgctgctggtcgtgccgggcgcgcacgggcgcccagccgaggaggacgaggag
ctggtgctgccggccctggagcgcgacccgggactcaggaccgcgcacctccgcctggac
gccttcggtcggcagctgagcctggagctgcacctggaccgcggcttcctggcacccggc
ttcacgctccagaccgtgggacgcagacccgagccggacgtgcagcgttctgatccggtg
ggcgacctggcgcactgcttctactctggcacggtcaacggcgaccccagctccgccgcg
gcgctcagcctctgcgacggcgtgcgcggcgccttctacctgcagggcgaggagtacttc
atccaacccgcgcccgccgccgccaccttgagcctggcccccgccgccgccgccgccgcc
gccgcagctggggagcagcagcaggcgcggccgcagttccatctcctgcggcggaggcgg
cggggcgacggcggcgccaagtgcggggtcttggatgacgagacccagctggcggggggc
gcggggccagagggcgaggacgccactgtgcagtgggcgccgcgggacccagcgccccag
cgcccgggacaccgaacaggaactggaagcctaagaaagaagcgatttgtgtccagcccc
cgctatgtggaaacgatgcttgtggctgaccagtccatggccgagttccacggcagtgac
ctaaagcactaccttctgaccttgttctccgtggcggcccggttatacaaacaccccagc
attcggaattcagtgagcctagtggtggtaaagatcctggtcatctacgaggaaaagaag
ggcccagaagtgacttccaacgctgccctcacactgcggaacttctgcagctggcagaaa
cagcacaacccgcccagtgaccgcgatgcagagcactatgacacggcgattctattcacc
agacaggacctgtgtggtacccagacgtgtgatactcttggcatggcggatgttggaact
atatgtgatcccagcagaagctgctcggtcatagaggatgatggcttacaggccgccttc
actactgctcacgaattaggtcacgtgtttaacatgccccatgatgatgccaagcaatgt
gccggcattaatggtctcaaccgggattcccacatgatggcatcaatgcttaccaatctg
gaccacaaccagccctggtctccctgtagtgcctcctcgattacaacatttctggataat
ggtcatggtgaatgtttgatggacgagccccagctcgtcatacagctcccctccgatctc
ccggggaccttgtacgatgccagccgacagtgccagctcacatttggagaggagtccaga
cactgcccggacgcggccagcacctgcatgatcctctggtgcacgggcacctctggagga
ttgccggtgtgccagaccaaacacttcccctgggcggacggcaccagctgcggagagggg
aaatggtgtgtcaatggccagtgcctggaccagaccgacaaggagcactttgatacccct
gttcacggaagctggggaccctgggggccctggggagactgctccagaacgtgtggtggt
ggagttcagtatacgatgagggagtgtgacaaccccgtgccgaagaacggaggaaaatac
tgtgagggcaagcgcgtgcgctacaggtcctgcaacatcgaggactgcccggagaataac
ggaaaaacctttagaatggaacagtgtgaggcacacaatgaattctccaaagcttccttt
ggcagcgggcctgcagtggagtggatacccaagtacgcgggagtctcgcccaaggacagg
tgcaagcttatctgtcaagccaaaggcactggctacttcttcgttttgcagcccaaggtg
gtggatggcaccccatgtagcccagattccacctctgtctgtgtgcaaggacagtgcgta
aaagctggctgtgatcacatcatagactccaaaaataagttcgataaatgtggcatctgt
ggaggaaatggatctacatgcaagaaagtatcaggatcagttaccactgcaaaacctggc
tatcacgatatcgtcacaattccaactggagccacaaacattgaagtgaagcaacggaat
catagaggatccaggaataacgggagcttcctggccatcaaagctgccgatggcacgtat
atcctgaatggcgacttcactctgtccactttggagcaagacatcacacacaaaggtagt
gtcctgaggtacagcggctcctcggcggcgctggaaagaattcgaagcttcagccctctc
aaggagcccttaaccatccaagtcctgacggtgggcaatgccttccgacccaaaattaaa
tacacctattttgtgaagaagaagaaggaatctttcaacgccatccctactttctcggag
tgggtcatcgaagagtggggcgagtgttccaagtcgtgtgggctgggtgtgcagagaagg
ctcgtggagtgccgggacatcaacggacagcccgcttcagagtgtgccaaggaagtgaag
ccggccagcaccagaccttgtgcggacctgccttgcccccgctggcagctgggggactgg
tcgccgtgttccaagacttgcgggaagggttacaaaaagagaaccttgcagtgtctgtcc
catgatggaggggtgttgtctcatgagagctgtgatcctttaaagaaacctaaacactac
atagacttctgcacagtggcggagtgcagttaa

DBGET integrated database retrieval system