KEGG   Bos taurus (cow): 512612Help
Entry
512612            CDS       T01008                                 

Definition
(RefSeq) histone H2B type 1-J
  KO
K11252  histone H2B
Organism
bta  Bos taurus (cow)
Pathway
bta05034  Alcoholism
bta05203  Viral carcinogenesis
bta05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    512612
  Immune diseases
   05322 Systemic lupus erythematosus
    512612
  Substance dependence
   05034 Alcoholism
    512612
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    512612
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   512612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 512612
NCBI-ProteinID: XP_024843155
Position
29
AA seq 155 aa AA seqDB search
MPEPAKSAAAPKKGSKKAVTKAQKKDGKKRKRSRKESYSSYVYKVLKQVHPDTSISSKAT
GIMNSFVNDIFQRITGEASRLAHYNKRSTITSREIQTAVCLLLPGELAKHAVSEGTKAVT
KSEGARPGRPRSGGDSPALGDLSSGNRTPEPAAPG
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccggctaagtctgctgctgcccctaaaaagggctctaaaaaagctgtgacc
aaggcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcctcg
tacgtgtacaaggtgctgaagcaagtccatccagacaccagcatctcgtccaaggccacg
ggcatcatgaactccttcgtcaacgacattttccagcgcatcactggtgaggcatcccgc
ctggcacattacaacaagcgctcgactatcacatccagggagatccagaccgccgtgtgc
ttgctgctacctggggagctggccaaacatgccgtgtctgagggcactaaggctgtcacc
aagagcgaaggagcgcgtcctgggcgcccacggagcggcggtgactctcccgccctcgga
gacctgtcctcgggcaaccgaaccccagagccggcggcccccgggtga

DBGET integrated database retrieval system